SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML038833a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML038833a-PA
Domain Number 1 Region: 571-732,813-916
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000119
Family Rhodopsin-like 0.0079
Further Details:      
 
Domain Number 2 Region: 490-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 524-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000034
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 4 Region: 285-307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML038833a-PA
Sequence length 979
Comment pep supercontig:GCA_000226015.1:ML0388:403199:411661:1 gene:ML038833a transcript:ML038833a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSTNTFQPKYLCGFYICDRGDDYSKPDSRFLSGIGVPWSLECNKVSQCEGDLDERHCP
EDEEAFICTDPTKKRISRTKLCDGKRDCHPLWGVDEVNCNHPYGMQCIKQYENVLIDSWV
SPNQICNGYKDCDVNEEDEENCDETADKTKCMPGYNPQNTTEYYIGDDQKCWRPDLSDFP
VCLDGKDQLNCTENISLWCDVNGFNTSITDLGLCTGYVNCDDGIDDKCEEVVPKCKVHKH
MTCDGIPSNCGDGVDESSSRCGAMTKNFTCHRRAFESTRSNIIPQAIPRGWACDGIQDCI
DGRDEDKSSWTVCSENTKFEHCIETHMVCRDVFICDGSKFVKQEDLCRNRDYCDKERNVC
GINVIRDILTRALSFGDYKLLGHCVPGINLVKDTGNPLLHCVENSFTFNEEAYGTVQSKL
YHPKSVQSCKSYFGEMYVYMSCLGICQDTSCPLQKIVHDSCYTQLDQFFTLTKQNTLTIA
KRLSQGGYTNELFPCKNKQCIPYDKVCNLHDDCGDGSDEENCENHFHCKADGRNISIALK
CNGHFDCADGLDECNEECSCQIINSKVLKATAWIQGILATAFNLFVAVNNLRKVKERFSN
KTSLTIAILAIFVSIGDMFVGVYLIILAVHDTLKGNDYCTSRYDWLKSFACTFLGVLNSI
GTQTALFSMVYISVFRAWVMRTQQICSRTIDRKYLLCLGTTIFIFIIFPSFAFSIAPILP
RYQDYFMNGVYYGKKNLLFKGVVTKREHIITIRNYHGRFLGAENSILSWQEIRKLVNSMF
TTEYGGMKGDNIGFFGNEGVCLFKYFVQQGDPKSDFTWSLLIVNFICFVVIACCYIYINY
VNLRSANKTKTDKSRKNALNVQRRISVIILTDFLCWVPCIVVCLLHYLGVINATQFYPFF
SILVLPINSLINPLIYDNTLNRSLMSVVRILSDKIFQLAQNFRTPQSSETQDKEGGIGLN
SMVKSTVTVATMIETELNS
Download sequence
Identical sequences ML038833a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]