SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML040718a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML040718a-PA
Domain Number 1 Region: 1189-1359,1430-1539
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.67e-20
Family Rhodopsin-like 0.0044
Further Details:      
 
Domain Number 2 Region: 481-565
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000641
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 
Domain Number 3 Region: 1110-1144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 1144-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000103
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML040718a-PA
Sequence length 1689
Comment pep supercontig:GCA_000226015.1:ML0407:134070:143594:-1 gene:ML040718a transcript:ML040718a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAINIDAAQYKVGNLGCWADKSSRAIPTLEGTHPALMDSWSSRVDPYERCLKATLDFGYQ
VFALQAGGWCASSSTALETYKKYGPSSNCASDGEGGGWANQVYLIKFDGNAVVLKATCDN
AMAAYVDGVYKYAANLDMYNVQSTVVIPNKFEVIAIKCVDTGGGEGLLASAENYLGELVL
LSDTTWKCSKVFEQGWEQKDFNASSENWKNAIDIGAKSWSVKGQISPYASWIWTEERVNT
IYCRAEMPYKREGITVTISCDVGFKLTTYYRAVCLNSSSYDVGQPLCVPITVERKEMFSD
FTADGTNMYTNLSMDISSTFFLKTMFTGSYDKECGMTFNILDTDVMYHLDFRLDMKGSYR
ELIQASRWNLKWGYKIPAIISSLPDLALENDIIVLVTDEYFEVTINNIMITPKFPSDLER
LYNYKGISIHTYGKCISVDLEKSYMTNGGGFVFSLINENNTKINLGQSSGLLVAKRAGFS
NAGTVCGKNFNNKSANILCQELGFRGADTWKTGLLWDIQNSYDVALSEVLCSPNAESFNE
CIYNTSTDSSTCGHHSDVHLSCTSNDDLCQINQHNGFMKLVCYDYNRLQYFKCLNSDVYY
EVEATLPGYSKFSALCENDPHFYQTCGAGHNEVFGGKDGVLCGYYICQDENGVFTSSYTA
ETSYSCDDKNQCSNTDMDETDCSYNFVKVIFDSVVGLTLPSSKVCDSYCDTADCMDESIC
GNAIYGLFCNGLEYYPPHYIGYYENWPNCAFDGSHTAEITCQHYISNLIVPLYDFNRCAT
FKFVKSVIDEAYWLSNEYQPYCKGFIDQTNCTDSERVAMTCDVNGYPATISKIILCHGLE
DLSLCSDGIENVCISLSPTCNIHKHQMCDKVINCIDKSDENDLVCTQLTSTTCLRRLGER
ELATPLAWLGDGVIDCMDGQDEKQVWPTCGLDVTFRYVTDNTTCTDDFLCLHGNADYIGM
VQLCDGIETCGNENEICRLSRDIPTVFTETHVSNSGMNKLRHCQKGLLNLQYISSNCTSV
TFSFPKGNVFGLSQRTVLEIPDGTLRCDNLFGELYVYYSCEGRCSNSKVMCPIKNNSLRH
DSCPGQFSDRAYTVINNQDLTFLFKSAGSYSIDLFVCENNRCIQFNKLCDLVDDCGDGSD
EISCSNHFRCASNTSYISTSQKCDGTIDCLDLSDECNAQCTKRIIQGAFLQVMSWMIGIL
AVLFNSVILFQNVLSLRKCSTALLLLNKLLIMLISVGDLLVGGYLVIISFVDSRRGSNYC
FSQQEWLTGAGCSLLGIFSTIGTQFSLFSMTALSTVRLFGIKNSMSIGSRLTKFGGLKSV
SVILMIVALSTAVALLPLHPSMEDFFVNGLSYETGNPLFTGFPDKRKHLKVLEAYYGRMK
KQSIKWKLIVDMVKGMFTNVYGGIKFKNVDFYGNDAVCLFKYFVKADDPQKLFVWAVLII
NFFCFILISFSYIFISIISTKSSKSLCKERGNSAVESRNRQMNKKISLIILTDFCCWVPF
ILTCALHTFGVLDATEWYALFSIVVLPINSVINPLLYDATISKMLGKVANKTKAAISQTG
PADSFATRSIFSKTQTSSLHPNFGTKKLASTAVNFKLEVMRIINKGVKVSSGAKHDDKHY
IDVSGVTFQTERLEMSQAGAIYANDTVEHVVKVTNRQHNPGFQSNADQNNATSSTGNKIN
CDIPAETQF
Download sequence
Identical sequences ML040718a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]