SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML04078a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML04078a-PA
Domain Number 1 Region: 629-806,883-990
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000577
Family Rhodopsin-like 0.0075
Further Details:      
 
Domain Number 2 Region: 556-592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 169-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML04078a-PA
Sequence length 1053
Comment pep supercontig:GCA_000226015.1:ML0407:44332:48455:-1 gene:ML04078a transcript:ML04078a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTTETILPMPDECRIGKHGGFLKFRCLGTRWGGEIYKCHKSKEFYVLETPFFTYSRGNV
CSNDPHFYQACDKRLDGFTISNTAFLCGNFLCQHTDDRIYSSHLLTAAKYICDNDMDCRN
TNLDEAGCSNKTTLPSGYKIESTNVCDDVCDVWGCEDEAMCNGFSYGLYCRENNSRSKKS
DYYVYPSWICDGTKDCKEKEDEANCTVGVVNTSKCRHGKTKKIVPVHNFTRCFVLDSDWP
SYCRDLKETQTNCSDSAKVAGSCRVDGFLSTVSKHVICHRKTGERAKICDDGIESKCLYI
SKSCYAHKHVMCDDKADCPDNSDELHPICRSQSRGVCQRKIGKEGRLTLPLAWIGDGTFD
CVDESDEKVDIWPTCGTDKSLRLVSSARSCNNVFLCLWGSPGYMELSQLCDGLETCGNEN
KICSLSRGFQLLSTSVTGSRHGLDKRFPTCLRGVQNIENLRQDHCTQTKFIFPEQSFFGV
ETKTELFFPNLSAQNCDHMFGELYVYTSCTNRCRNSSCPLRNLPRYEACPSQYPRRVGTI
ANDTYLAFFVEPHEKTYINNIFVCDNKIKCIEYSRVCDLVDDCGDMSDEVSCTNHFSCNS
SRRLIPKTKQCNKQLDCVDLTDECNDQCSKQIVETPFLKIISFIIGSMACLANFATLLRN
IWTLDRCKTSASLINRSLIIMISLGDLMVGCYLLVIVFYDVIVYGTTYCINQVEWITSDS
CSVVGAISTIGSQISLFSMVGLSVSRAKGIRSSFKKAGEVTSALRRKIIFGEVLITALSV
AIAVLPLVGPLEDFFVNGVKFSERLQLFVGTPTKHDILPVIGAYYGRIKKSSLSWDVILE
MIRSMFSHDYSYEDHTKIITKVHFYGNDGVCLFKFFVKKEDPQKHFVWTVLATNFFCFIL
ISISYIYIGMVSQNSAKRFAKVPHCRSIIRRNRKLNRKVAIIITTDFCCWVPLILICTLH
SLEALDATPWYSLFSLIILPINSVINPLLYDDVVASIIKSSFTFIPSQIFRVKVNLEKLC
VAKTNSVTPDHVEELTQIKVKKRSDVVNIGGQI
Download sequence
Identical sequences ML04078a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]