SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML044130a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML044130a-PA
Domain Number 1 Region: 103-301
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000000191
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML044130a-PA
Sequence length 320
Comment pep supercontig:GCA_000226015.1:ML0441:246993:249201:-1 gene:ML044130a transcript:ML044130a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWVLCLLAISCGDSKRLAVHPREKNRKPLEIQASLKGGAAPDDVNKRSKRSYYDHDED
WNNKINITKSVLIGDSHGTAYVEWGGTDKNSDVIIILTKDSSAIPRDSTLYISIDYGKTF
TIKRIMVGNKAAIFSYIYQSLTNHQQFMLNDIVNKAVAVSEDEGRSWQVYATDFTPSIID
HHPKLENLLLAHDLQKRKLYVSQNFGRSFTPIRSDLNIVDFYWGTTKYDRDNSVFLVADN
GDGTQAIYSSDDFFKGDTNIIDTAANQFAVIDEFYFYVKNSTHSDHGDDDLDLFISFDRS
HPVKAQFPPHLSGFSTTVCF
Download sequence
Identical sequences ML044130a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]