SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML049310a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML049310a-PA
Domain Number 1 Region: 711-872,958-1067
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-17
Family Rhodopsin-like 0.01
Further Details:      
 
Domain Number 2 Region: 632-667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 669-703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML049310a-PA
Sequence length 1132
Comment pep supercontig:GCA_000226015.1:ML0493:104186:107584:-1 gene:ML049310a transcript:ML049310a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEIVLQVFGADMVLLLRFVFAISTINDVQATKRGKCKFIFYRTQSEMISRKILYRFQL
VSGISEKTIKQVSKLKFSDCKIEENNGYLKYVCHEEGSITEYKCLYSDEFYIQNDFHDEI
KYFYNGTNICQNDPHFYQACDNRLGGKVTNKEVLCENYYCKGTGQYSGRILTPLGLSVLG
KCNVDCANTVLNKEGCNDEKVALPSGKLVRPRDICNDVCDDAFNCEDEANCNGFLYGKYC
LRSEKLHYIPPWGLCNSKSKQNCDGGEDKENCTVTSSTDSFCRHIRTRQTVPVHNNTRCG
TVQRSDYAKPGEKFVTKPQLYCVLDEIAAYQTNCSDPARVALTCEINGYTSSVSRYILCF
DDTMSVCDDHIDSSCYSTKSCKVHKHLLCDENKDCDDKADETHPICLKKTEGTCKRRVGV
GRELPIPISWLRDGVWDCVDGIDETAEWPKCGVGKTFRYMASAETQCKNVFICRYGSPGY
ELLDDLCDGLENCGNENTICSISSRSQGLTTKVSTTNMGLTKTLSFCRKGLRSLELFIST
CVDKGFMYPDGNIFGMETKTSVIVPHSKQSCDYMYGEQYLYTSCTGQCSDTSCPLRNIPR
YEVCPDQFPDRVGTIVNNEYLIFLTKSFGTVYSNRFFVCTDNKTCIDYSKVCDLVHDCED
GSDEGECTNHFQCKSSGKLLPKTKKCDGQIECADLSDECNEVCSKNLLEGYILKGLTWLI
GLLAIVANLIIIGKSLGTIKRCKTSVTLINRILIIMIAMGDFFIGCYLLIIAIYDGIFFK
QDYCEQRITWITSYECSVIGVLSTIGSQISLFSMTGLSIVRIYGIWNSMKIPGEVKIIDV
FKIAAAILFLILFSTTIAVVPIVEGFEDFFVNGVKFSKELKIFIGSSDKATVTKVIQAYH
GRTKDTTLSWKMLIKVVREMFSRDLDYEDLTERVDKVDFFGNDGVCLFKYFVQNQDPQRL
FVWSILVLNFFCFVLISISYLFIGILSRRSSRSLGRSSGNYRQIAERNNRMNRRIAIIIA
TDFLCWVPFILICILHSVEVIDATALYSIFSMVILPINSVINPLLYDDVVTKIIRAPTCC
LAIRISCPAIFRRFYQRASPAPAVEMTLQQRYPDFEKTADTTHTRSTRTTKV
Download sequence
Identical sequences ML049310a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]