SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML050815a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML050815a-PA
Domain Number 1 Region: 675-849,918-1017
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.68e-17
Family Rhodopsin-like 0.0052
Further Details:      
 
Domain Number 2 Region: 599-635
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 636-667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000694
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML050815a-PA
Sequence length 1083
Comment pep supercontig:GCA_000226015.1:ML0508:78931:82442:-1 gene:ML050815a transcript:ML050815a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGSYSNFTWDGVKLTLLMILSVVFVMSTGTFEVKEVEGFLKLVNEKNEIKCWGTDVTY
NVSAEVPDYCLSQRYSALCTEDPLFYQGCGAINSTACLGGQYNFDRGYALCGFHICKFLR
RGQIAYWSGKSIEWYFDCNGVNNCENPGNEGLDEKICPELEDPFICHNSKKRISREKQCD
GFVDCLSDWADDEHGCNHTYGLDCYNSWTNSPRWQVPRYVCNKNRTWSFQCKDDIDLSKE
LCEDQVIGWCYYRLGYANEGQIVKRNLTKNHMCTPFEPGIIGPCIDGRDQTNCTSGSSSV
LTCPVETYQTTMTALGLCTGFDVCDDGLDEKCGVPEHGCKIHKHAYCDGNSDCPMGSDEG
RMCNFMVSNKTTCIRRVNMGFIEPKEIPVAWLCDGMADCQNGMDEDEINWAVCGSPWTKI
RCFEKGETCQEMYKCDITNSTKFVELKYLCDGIVSCDNELDVCKVSTDIPKLVTTVSSVG
RTKNILHCLPGLESLQRSHAPCRVTEFTPLVPAFGVDQIEAEIPTSLLANTFCDHSFGEL
YVYLTCLGLCAGRKCMAEPIGPKQCVKGILHKIYTLSKDKTRLILVKKGGNAEGTSTKFA
HEEMFPCKNGNCVPYEKVCNLANDCGDDSDELECLNHFMCGSGEFIPLSSLGDNKVDCRD
QSDECNPESHVRIISHTYLEASSWIIGCTASLTNSFILAKQVRAAFKSTTTIALFNAIFV
CFIALGDFLVGFYLLFLSIANQVKADSYCKEKYQWLTSINCSLLGVISTLGSLLSLYSMT
LLSVVRAYNLTQLSVPQAPTTKEKLKIFLTFFAMLILALLVSCIPLMPVFEDYFINGIYY
GTEVPLFTGAPDMTKHQQIIDTYYHTKSGKLSWKFIRRLVTGMFTSDQALVGGRDLGFYG
NDGVCLFKYFVKDTDPQRAFSAAILIANSVCFLTVLVSYGLVTAVARSLSSASNAARSNS
KLQRKITIIIVTDFICWTPFATVSLLNYLELIDATSHYAFFSTIILPINSMINPLIYDRI
LTSRISRIFKKSKEKVKTLTILHSRSEIPYNAERNEEVELRALSKVKTLTSLALSSPSRV
SQI
Download sequence
Identical sequences ML050815a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]