SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML05382a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML05382a-PA
Domain Number 1 Region: 397-849,951-1024
Classification Level Classification E-value
Superfamily SNF-like 7.19e-109
Family SNF-like 0.0000968
Further Details:      
 
Domain Number 2 Region: 218-346
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000105
Family FkbM-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML05382a-PA
Sequence length 1070
Comment pep supercontig:GCA_000226015.1:ML0538:4986:16985:1 gene:ML05382a transcript:ML05382a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFESCCNISSTKLSRNLRPYRNLILVVLIVGVVCFSYFHIASLKDELLTRLNENPGTI
DEVDLDSSLYDDGDKKGVDIQIKRNRIKQEDLMRRGGFAPIKKLKLTTDEPPVEIPDFFP
KIEHNCKLSLKRVAGAWISHLRDPGDAQHRHRTDSWNLCFDEKLTRLNAFTPRGSGTSCV
VYSFGMEDNWSFEEDMLLHNCEVHMFDSSKEKHSSVIKRKVRNLTIHRAVLSDHDEQKAA
FIQGEEREKENLPPDKKTLSSIMEELSHTRVDVIKVDIEGEELGALEQASKSLVDGVDQI
LLEVHMHISEHAHDSAKPEHFEQATIDKWTKLFKSLRDDGYRVYDIRAKECERACCRENR
GYTMIRKDKEALTSQMSTSSGKDKVEEELLASREESREKWSSQYSFFLGLIGSAVGLGNI
WRFPSLIAMFGGGPFIVAYIVVLLLIGLPMMTLELTLGQKFQGGDVDAFGAINPRFRGIG
VASVLSSFIASTNYTVILSWAAIYFFESMMPSLPYSIHSKEENPEGKYSFDRYIYGAKVH
FNSTHFGANSLDEVHGNFNWKSFGALLLIWLLIYACIFKGIRIVSHVVKVTATVPVIIII
ILAIMGSFQEGATNGIMVYLGMSEENVAVGVDSSAPSSWSVLGNKDIWIRAIGQVFFSLG
LCMGCVTAYSSFNPKNQNISRDGKIICISDFVASLLAGVSVYEMLGFVKKTCNETAVDKT
LCKDIYSKGGFELAFVTYPAGIAMSYSPNLWGILFFGCLLFLGIDSAFSMIIAFTTVIED
AWFAKRWKLTKPVLTAIVCIVGFLLGFIYLFDTGYFLMDIADHYLSDWCLMLIGFVQAVA
CGWVYQSPYQAKRVGKFSVVLYDMCFFVAITLGVIIAVSGNEDSDVDVIWVGVFIGMFVW
IFGLVAAVLLSKGRVNGIREKIWCIAGWHGPDMIRRMVNKEYEPEWEPGHARDEAKALLR
FDMISLPFGFLIKYIIPGVLLLLVGLALSKDLKEPYNGYAMAWNLLGILIVISVLSCMLI
LFLFPRLWYDIKYSGEGDPTLSSWLKWVFIPKSVNSVEDIKLARKRSGGA
Download sequence
Identical sequences ML05382a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]