SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML063327a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML063327a-PA
Domain Number 1 Region: 305-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 386-421
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 346-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 250-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML063327a-PA
Sequence length 426
Comment pep supercontig:GCA_000226015.1:ML0633:215435:222525:-1 gene:ML063327a transcript:ML063327a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLTLVLIIALLLVSDVDCQRRKKKKKVTTPPPTTTYMTTSGATTSLLVTTSDTQTPPP
VQTQQPASTSESIIETDSMETTTTEPVQTEETTDWSKVDETTEESINTTESPTEKTDSME
TTTTEPVQTEETTDWSKVDETTEESINTTESPTENITTEEGTTESSATTQTEGTTVTAGT
ASLTGADSEEEGTGTTFITGSTTFITGSTTSMFSSSTFLTSAAAVETEPPSTQTMRFDST
PEPTEADFNICPKHRYSCLNRMKCIGRGELCNGKKDCPGGDDEEGCPEKSDEVLQEGVVA
TAEPLACKDDEFSCPGERRCLHERVKCDGVRDCSNGEDEEDCKVLKCTFNEWLCEDGLSC
YAKTEYCNGVRDCKDNSDESSCKKEKCRDGDWQCKNGDCIADIFRCDGYPDCDDHSDEKE
KECENF
Download sequence
Identical sequences ML063327a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]