SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML06467a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML06467a-PA
Domain Number 1 Region: 753-934,1018-1126
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000128
Family Rhodopsin-like 0.0059
Further Details:      
 
Domain Number 2 Region: 670-704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML06467a-PA
Sequence length 1165
Comment pep supercontig:GCA_000226015.1:ML0646:38316:41813:1 gene:ML06467a transcript:ML06467a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQIPGCCDLFDLHLLFYLHKIWKHIIWKCNSNISGEPWISWRPDKYCGTKNLLPDGSPA
ECDPNGENYCCSAFGKCIHISTDNYAFFCTCEDCVNYRIVHEIRKSGKSCATVNVQEFLK
YVCFNEETRMVNYTCFNSDKQYSANFYNIGDPNKIGHLLIEGTHVSSLCENDPYSYQSCG
LLNKKIGKGNFLCGGYLKYVCDPHYQSLHESSGKELFKYIKCDENCSDNGDCSKPEAGDV
KKGEEMLCDDKCDGDVCEDEAFCNGYRYGITCMVSDFEGYASYHLPLPAVCNGIRNCVIH
SEDEADCEISNTADETGTCYRNTHIGKKLQVPLRNYTRCAVFSQNIPPYCSDYRDQTNCT
DIKRVGGRCFIDGYMSTVSKFVVCDQLNVNRPTNLCDDGLEQSCVFPSGDKWCRIHKHKL
CNGRYDCLGKSDELIDDCNPLSLSTNFTCIRTFFPGEYLPLPSSWILDGARDCVDGEDEN
LTMWSFCGSQEEGSLRVKEADEACQNVFLCPGHSISFVKFDNLCDRVESCGMENQVCWIA
RDFPREVTIESMAVHIGTVVNLCKYENMNTCSSEKFTYGETFGETFGVDNTVTLIISNHS
VNCSEIFGEYYVYHSCMGYCSEQTAKCPLNNQPLLYDSCPGQFPDRVFSVANNSYLTFVV
PNKSGVGYYRPYIYQCNNNKCIDYEKMCNLVDDCGDGSDEENCINHAVCHSTVDQPKKHF
ISLQQECDGIYDCFDFSDECNEKCGRQIFDNLLLKIVCWVVGVLATIFNSITVSRGLDAM
QACETNVLFMNQALANIISFGDLLTGIYLVVLSVFDSLLFGKEFCRNQAEWLTSTTCSLL
GVISTLGSQFSLFAMTTLSLIRASGLIFNLERPRNVNKQDVLKTAAVVFGVTTLSIVVAL
TPLTSILEDYFVQGMYYNPENRLFIGFPDKSRHLKILGAYFNNTNQDMELLTSHLPWKDI
HSKVDQMFSSQYGKIERTPVHFYGNDGVCLFKYFVRSDDARRSRNTVRRMSDITDHKGDL
IVWIMLGVNFTCVITITICYFFIMLFVKKSSVESGSDQSPQKEKETQLMQQRISFMIISD
FFCWVPFILASAAHNLKIIDATQWYLSFAMVTLPLNSFINPLIYDSQLRQVFTSAKMRVL
AVNKRQRNLEHSAEEIDMEVINETL
Download sequence
Identical sequences ML06467a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]