SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML064932a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML064932a-PA
Domain Number 1 Region: 734-918,981-1109
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.06e-16
Family Rhodopsin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 659-692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML064932a-PA
Sequence length 1153
Comment pep supercontig:GCA_000226015.1:ML0649:305901:309362:-1 gene:ML064932a transcript:ML064932a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFQFAIDYFPRPLRTVDVGTVVFTLDTLSCMVDTNKTDGKNVPNFRLTKINTAKVERLK
NEIGNRETLILLCGPVPEYCPVVEKDNFLKRVCFDDFGTTVLQCPYSKTLYTSAVYSSEQ
TIVLSAICENDPTFYQGCGIRDSSTMLRSIVNVNMNSSALCDDFICMAAGNETLRAHSLV
ANSYRLVSASELCSREKTCGRQPCQNEYTDCTDIELPEEFCSTILELPTGLIAPKSKLCN
GRCDVHYRCEDEAMCNGLVYGDYCMDYDNNLIYVNPSDLCDRQPNYMCLNSEEDSSCPDP
LLVPEKCRKSSSPFSLIPITNRTRCTAPWKDLVVNLDQQFFPLCTNFIDQTNCTDPSRSK
VVCPINGFQSTVSEFFVCHGQAEIPALCDNGIDQVCLEVQVSLTCRVHKHQLCDELRDCP
DGSDENLSICRSMADKECYRAYIHNSALKIPSAWLRDGVEDCLDGLDEQDIWPSCGEGRT
RRFLASDTASCEEVFLCSHQQTAFVQFQHLCDGTGSCGDEKSMCDKSQLAIPTLDKVVKS
IEKSDRVEKLLFYCLPGLESLQKKADGCIQYYLGPIAIKVFGINDLSIMIPDKKINCDYT
FGEIYVLLSCAGLCKNSICPIRNKIEYNSCPGQYSNRIYSLAENKYLSFVTKSREGYKND
YFLCDNGFCIRYDQVCNLIDECGDGSDEHFCTNVLVCDSKRQLIPISEKCDGKIDCSDFS
DECNSECGRDILQSSILKFMCWLLALLATALNIISIIRCASKFSWKISVDALYNKIFLLL
INLGDLLVGVYLLQIAVMDLIIYRGRYCKNQVSWLSSSQCSLLGVISTIGHEVSLSSVTV
LGLARAIAIRKGVKISKHISRISISKIALKVSTIVAVSFAIALTPLATLLEDFFVNGMTY
NPSVRLFIGSPGKDIHLNILQEYYGKVKEKNLKWRVINDLVDGMFSHDYMNNAIGRKKLD
FYGNEGVCLFKFFVKAGDPQRNYAWLVLFFNMILLGIISACYIFINVNTRESSHVLTREK
TPMKERIQKRNKKLQRKISLIIVTDLLCWLPVTVVSCFHSADVLDATPYYSLISIVFLPI
NSVINPVLYNDIFIQTVKDYARRLFQFSILQDNHGQNSQGKKSARGFLSLCRNAKIFTST
SSTTATTGNRNTT
Download sequence
Identical sequences ML064932a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]