SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML06551a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML06551a-PA
Domain Number 1 Region: 1032-1203,1279-1385
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.56e-17
Family Rhodopsin-like 0.0095
Further Details:      
 
Domain Number 2 Region: 171-250
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0053
Further Details:      
 
Domain Number 3 Region: 66-145
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000327
Family Scavenger receptor cysteine-rich (SRCR) domain 0.009
Further Details:      
 
Domain Number 4 Region: 951-987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 989-1024
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000995
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 6 Region: 255-393
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000604
Family Fucose binding lectin 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML06551a-PA
Sequence length 1437
Comment pep supercontig:GCA_000226015.1:ML0655:9323:16217:-1 gene:ML06551a transcript:ML06551a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQDHYRYQKDVVHSIHRYTTLMNIARFLHLFTISSIRFLTVFRLIDSDGEDVDAGMLGV
LLYQGGTVCNDYFDNIAANAICREMGHSMSTSWKSGINLLFGKNRTSLDITLDDVKCIDN
KWTSCSYSISNIDCDHSEDVLMSCQADFSIVDTNSEKINPGFLGLLLYEGGTVCDDSFND
NAANAICREMGYSRSTWWISGSDFSFGESQTSLDITLDDIECSDNDWKSCSYSTSHNCGH
NEDVFLSCQADKMRILPTSVSQSSTWESATANLAVDGRMATNSNTQCGYNTVIWFRMVFD
DVYCFSEVLIFQSHMDNLNAPRMDGTTVIVENSETESRDICGRLVIRHDFTVKGQTYNIP
CDSLCGNSILLEVNHGSGSAREGCIHMKEIEAYYSAESCKLVKKSGYLKMECTNSIDGEI
YYQCHNSSGWYSPMITSGMTGDFGEEFITRKFERKCENDENSYQACGMEYSQRVLKSFEN
ALCQVKISLMNGRVSTELIEEQHSPKGGKVALRSGLIIDKNTICNDVCETDGCEDEASCN
NLTYGQYCHINDNATEPIKYIIPEHICSSLYHEKNCCKNPSKDRSYVCNAISMCNPKTVE
NPTVCRRYIFDKLRGSRPLFGRYILLNITRCFPRIQCHGHIDQTNCTDPQRVGATCNIKG
YTSTVSKYVVCKSAPGVTYNKMCDDGLDQVCEQISHSCRVHKHQLCDGSPDCKNMVDENL
SICQSKTILPCLRRAGNGTFSQTFPTAWLNDGFVDCMNGEDEKIGIWPTCGVGESKRYAT
ENSSCTNVFLCRTKTLKFVELKDLCDGIDTCGNENRVCKASRNTVTVMNEVPTNVGKAGV
KKSFSYCLKGLEHLRKLTHECTSEKFIFPDDDIYGVSKTTISLPNMKTNCDNLFGEYYLY
SSCTDKCIKSFCPLTSALRHDSCPEFYTDRVKTIANNQYLTFAVKGRKPGHYTNNIFSCV
NGIKCIPYHRVCDLVDDCGDGSDEQHCTNNFRCGNSGHFIPRTSKCDGKVDCLDHSDECN
DECSREILNGSLLKGFSWAIGVGAVLANLITLTFSFWMMKKCRTSVALANKSLVALVSAG
DLLVGCYLLTLSFYDEVGPKENYCSQQFLWLTSNQCITFGVTSTIGSQLSLFAMTILSLV
RAHGILNSMRIPGEVNVKNVIRVILIDVSILASSVIVAVLPLLKTFEDFFINGLYYDAGL
KLFIGLVDKKTHFRVFREYFGRLSGRVLSWDQTDAIVAEMFSHDFEYEDYTTSRRKVGFY
GNDGVCLFKYFIQEKDPQQAFVWIVLVFNFLCFLVISACYIIIGTLSVKSSRTVSSNGNN
HALQRARRMNRKISIIIATDFLCWIPFIVTCMLHYLAVLDATSWYSFFSVIILPINSVIN
PLLYSDFIMARVVKATSHSKRITMGWLSRVTSQTTLKVGPVKVETDAEKEIIEMEKK
Download sequence
Identical sequences ML06551a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]