SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML065713a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML065713a-PA
Domain Number 1 Region: 994-1145
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000238
Family Rhodopsin-like 0.013
Further Details:      
 
Domain Number 2 Region: 677-711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 751-912
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000011
Family Rhodopsin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML065713a-PA
Sequence length 1184
Comment pep supercontig:GCA_000226015.1:ML0657:47518:54515:-1 gene:ML065713a transcript:ML065713a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSREYGVIDIGRSRAVKKMFQCRFPLDIPRVLLDTLSVKNLRRFFTRLGLQDLSHTDQ
FYNFTQIDAFRYNPRLPIFDSIFTSRCDNDKKFYQACGTGNMSIISESKTFCGRKICSYK
RGRLNNVCSKYANIGRRIPQKSVRHVITIGEANPCEITDLPDEEINNNEEEDDSTENEIE
DTCSTLNFPDTSSCMREAVCKNLTFGLFCDGKELPEPVKPTVIFRLASCENSAFTVQPTI
NVFNSTRRPSPNITNSTRRPSNTTEQIQQSNTTERPERGKFLDFVNMKNRIRGKLNRQGR
STLRERNIDQTVGGCHNHGKHCNALDIVKRIARGITTQEDLKIFNFTRCNTFRIPLCKNG
IDQIDCTDNPDQIGLWCDINGRRSSISKQRVCLKTNLDDLDPGPLCDDKLDITCLACGVH
KHKICDGVHDCRDKSDEIGCNLMQMAEKTCQRTGGNGTELPIPLEWLLDGQADCMNGIDE
SEEKILSCGKGRLRRLTFNSYCENVFICKSGDKGYVQLDKLCDGTVSCNDERRVCAVSQD
LPVLPVRILGPSRKLKKHMSYCLPGLEELQRQRQEAPCQPESFIFPDHNYFGITDKTELM
RPRATPDLRHLFGEHYVYNSCRGDNTESCPLRDIPYDSCPGQYRNRIGTFASNKSGADTS
DNSYLTFFVKSSGDSYRNNFFVCDNGEKCIEYSKVCDLINDCADGSDEIRCRNHFSCSRN
STQKIFIPWTSYCDEKFDCPDLSDECNSDCSKQILHSMVLKASTITIGAIAVVANFVVIF
NSFQSLSKCKTPIALANKSLVLLIGVGDFLIGGYLLLLTAADIFFTTMENGHTGYCRNQI
KWLVSYKCDILGVFSTVGSQISLFAMTVLSVLRLFGVLNSDRIQHRTTRRYKMLIGACVF
LIIFSSFIIAVVPILPMDFFISGLAFQEDLKLFVGIKSREELFAVIREYFGRTRAPGADD
KQWSWGRTEKFVRDMFDGASNETTNIEIYRLGFYGNDGVCLFKFFVTPEDPQRHFVWFIL
IVNFICFTTISVCYITSTLFIRMTTFAAKALNRSGSTLSNVEKSHIKRQKSLQHKIAFII
FTDFICWIPFIIVCGLHYFKIISADDWYAFFSVIVLPINSIINPFLYDEVFTNALKGLWK
TCRMHGITCSKLIEERRIVSSSGNSSVGSVAARPSSDPKAETPS
Download sequence
Identical sequences ML065713a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]