SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML065757a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML065757a-PA
Domain Number 1 Region: 288-465,539-614
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000467
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 217-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 251-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000864
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML065757a-PA
Sequence length 627
Comment pep supercontig:GCA_000226015.1:ML0657:487718:489601:1 gene:ML065757a transcript:ML065757a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHERALRIPLNWLGDGVEDCLDGVDERDMWPSCGVGRTKRFLDLDNSYCGEVFLCSHQQA
AFVQLQDLCDGKFGSCGNEKRICDKSHLAVATFDKPINVEGSNRNKKFLLYCLPGLESLQ
NLANRCVHKDIDFLKSEIFGIKKLTLALPDTKIDCDHTFGEVYLLLSCAGFCTSSPCPIR
KKIEYNSCPGQHTKRIYTVADNEFLSFVTRSRDGYKNDYFLCDNGFCISFDQVCNLIDEC
GDGSDELSCTNVFICDSENQFIPMTEKCDGNIDCADFSDECNTQCGRQILQNMLLKVLCW
FLGVLATALNCVSIAKILSQFSLKASAEALNNDVLILLIHLGDLLVGIYLLGIAIIDTVV
YRSNYCWEQIKWLSSHTCNYLGILSTIGYQFSLGSVTALSLTRVFRIRKGIVCKEDISKN
TAVSITIKTLSILAVSFAGAVVPLMPHLEDFFVNGMTYDPLIKLFIGSPGKRIHMNILQE
YYGKVKEKDLTWRVINDLIDDMFSSDYTDNAVGRKKLEFYDNEGVCLFKFFVTADDPQRI
YVWIALTVNMTLLGIVSACYVLISVYAKSSSRVLTKENTPTGEKIRRRNNKLQRKITLII
ATDLICWLPITIAAHNYSVLPTFSEYF
Download sequence
Identical sequences ML065757a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]