SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML069711a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML069711a-PA
Domain Number 1 Region: 734-918,999-1100
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000128
Family Rhodopsin-like 0.0065
Further Details:      
 
Domain Number 2 Region: 677-708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML069711a-PA
Sequence length 1153
Comment pep supercontig:GCA_000226015.1:ML0697:119495:122956:-1 gene:ML069711a transcript:ML069711a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQNLTMFTKNGEIFGIFFAATFVILTDNSLYETPKNKDVVRYETITNRPVEHQPEGYTNF
HRNSSFTVSNCSFFVTEGFLKERCLINGIWFFKCINSSGFYQVSFRPANSCKATIFNKVC
LNDTKFYQACGHSKSKCKHEKGFVSNRGLGSIFDSSVAACGHLVCQLSTSQHYGFKNRLG
IMTSEVGTLDLLICENPHEDFCLNNVEGIPVHQYVCKALKKVKEYDQNNDFTNINRSEIC
NNMCDHYNCRDESLCHNMTIGIFCKKVITYNPEPYSEDNYVPPNHICDGIQHCKTGDDEV
ECDRSEEFCLTINAALMWKLAKSYEKPVHRALTDRSKCGHPSTNRVIQVCIDYRDQMNCS
GSTISPLLCKVDGYPTTLSEYVICQGHDLCDDSIDTVCVEVVAGCRIHKHRLCDEIVDCH
GGADESDHFCKDVISVHSTVACVRQLSSSNSPMRLPNRWILDGTVDCRNKMDENIDIWTE
GCGSGWAAYRTLSNQSSSDCSQVTQFKCPGSLGNLDLNRVCSGNKLKNCDFGVCITARKE
YLTKIYDSLDTQQTINVSKRTLFCLKGLNELQFLAGKCSDIRLVNQKRVMGAPDLSVVSS
KKFSQSYIDCSGLFGELYVLLACAEICSGVSKKCPLINVDPTSSCLNFSPSEVVLSLAED
GTLAPLVNLGGNSFDKAIFSCDNSRCVTFDKVCNVADDCGDLSDEVDCSNNFKCNKSGEY
IPLSSKCDKKFDCFDYSDECNEECRNQVTMFDHVSVKIFAWIFGSVATCLNVLTLFHGIY
QYKDLKNETGRVNKIFVLLITFGDFLQGLFLLLLSVGEQFYNNSTCVTQYDWTTSSLCNG
LGVFSTVGSLVSLFSMTALSLIRVSGVRSMIQPKEKLSRKKASSLAVSVLAILAISLIIA
LFPIVAFEDYFVEKLTYNGNPLFVGALNKKEHLRIIESYYGRIHTRVGFSKSAMSWNNIR
NLVKGFFANNVVVGSGIGFYGSNGFCLFSYFVKEDTSFKWFSISVHFTNLICVTAIIICY
IVISGFALKSSASVAGNRQIGKKNRKLQRKITILITTDILTWLPFIFVCAINYFELSDTS
SLYSFFCVLFLPINSIINPIGIYDETIWLTIKEVGSKLSLKDPALRMWARFKELASRPEQ
PDVVIEMAEMSQT
Download sequence
Identical sequences ML069711a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]