SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07013a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07013a-PA
Domain Number 1 Region: 3025-3226,3293-3401
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.37e-20
Family Rhodopsin-like 0.0075
Further Details:      
 
Domain Number 2 Region: 412-498
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000994
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0072
Further Details:      
 
Domain Number 3 Region: 1296-1329,1370-1422
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000798
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 4 Region: 2166-2256
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000102
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0093
Further Details:      
 
Domain Number 5 Region: 2967-3002
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 2305-2386
Classification Level Classification E-value
Superfamily SRCR-like 0.00000968
Family Scavenger receptor cysteine-rich (SRCR) domain 0.036
Further Details:      
 
Domain Number 7 Region: 2579-2601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML07013a-PA
Sequence length 3536
Comment pep supercontig:GCA_000226015.1:ML0701:21587:37995:1 gene:ML07013a transcript:ML07013a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAYLELSGLELTYKNFLSPQHRYGRPQKRFVRTIFFRPLAIATSGESILLKAPEKFTH
VTKFVRDYLGTLESNTYVFRDSQQNKLTYEVVNLAKHLVYFGFFGFKDLLALTKTMLSIL
DCVKGPAKVGSHCRAQGSMPSLESGAQSAGQPAPPSSDAAAGAAPAEGATEGGESSENLL
SAITGGISLSKGSGSAKSESDVIVMNTKLKIIEILEFIMNVRLDYRITALLVIFKRDFAG
NQRSEALENGGDRKTSGPNLPGNGVYSNYWKYCHYSTFKYFVCNRKQHVYKVYAAYFVFA
ELQNSTLEFRLVVAIALQHLKSYRILTNAFTSNKSAVDYEKRILATNMVKTKTGQLRNLL
TFLFLATVLFHSVTTIEYHVELWDKQGRNTKNSANVRFGLLVIIENPGLETQAFGTVCVD
GFNVHAADIVCRDLGFHASSGFKANKDFANFSQLKLLDVKVLYEKVSCEVYSRKLKHCKF
KKNTICAHSQDVVVECVHSHQIGPPDANGNVPVSLRLNSTSSFNDTSNTDTTDASYGILI
GTVAILDAEYFHEIEGTILWDPQEDYRDAGLCDAAGFPLGFRAAKPSRADMDFEFAFGYR
VLTSLPVRCTDGICKITGQKVVDDMFASFHDHFYNMVLMCEPEISYKVFTKVVCPYEGEA
ITCGGLIEITSARYGVPYNDNLCGAVLENGPCSIDVTHFLAAECEEKTTCDVMAADFLFG
NPCNSTSNFLEVSYRCVQLHPIVRVDMETETLTSGVPAEFREVMLYAILTASTLTESDSE
GVVCGDGNMNETSLLALGGAACERAGYTAAALFVTEVLYGTSFYKVSCSKNSYSYQCNGY
RMEDHEECENVIALCLATPEKLARVFNWKLLLSDDTQTQNGGFLVLENTLTGGNLVYPYF
EAADSNYEEEIEEFLGRILSMGIVDDFCHQFGFVSAENVSLVSLDEDAVQCLPIMYYGNF
GFDGSGFSIDISDLDNILSQDQYSRCKKKYIKVICSEKMSSQHHSRVYTLFPLLRFDDGV
NLQTPVFALSYMNWTDNNLDRGFVCHGVFPAVVLEDICKENDYDSLVGFSSLVLQEPEHA
YSQLGMLAKTPVLNGQTCGDDIELCTESYTDCSVYNIQLLSCVDIENDIEFEQVRLAEID
ETLSSYNWTIPYAVKNFATFSHDETHAILICAGEDIETATGLMCLGSYVNLGSIAESDII
LQQVFQPNLETALFISNIKCDPSFASRLFDCNITFGRCPAEKLLLLDCLSENITFSQLSF
QFSLINDNREPYRGIVNRGFLLATLINTNSGVSKTGTVCDDGFSNYNAHVICNEMGFHFS
RNIGNTSFHNEDTFDNRRKRRDIPTHQTDPMFLDEPADDIRTKRESNPVPLENRLSYEIV
LDDIECPNLDDSSYSLSDFSTCEYSTQHNCRHNEDVFLACSGLVFKLVGKLEKASSSFSG
FVQAVVFDGVNENSSWNFIIKTITDADLVCMTLGFPSAFRYQTVDAEVLEDLAFHDLMGS
IEIEDCTSQTYCEFITYVSISHTYYLECVVEKADPIGLVDRVGAQSHYNGLLVTKSTENS
IDMVCGPLDYFPDSMADLLCVTLGFQTAITKYTIDTSTDNAFGDIISDYQGGGNYAVVFC
DPEGGFCRLQRLKNSTCLYAYYLACSPDFQVIGKSLYWDDKEVGNDGIFFVSVDSSSTDI
PSLVPVCSDPTLEGGDSVIDMFCRWFGFYSSYNEHEIVTEGMTEVQLWATFSDCQEGGEC
RIGLFAECQGGAVMLRCFDPQLKFMFWTSVVDGPTSGLSGILQAEFFHNGKLSSGLVCSD
DVSPMIISLSCKSMGFNRGFSEVNVKNITNTPEFNEIEWLSISAHCSLETGKNICGYNIE
YPYSPLNSSFAIVVNCSSNIQDIVVRREEEEYKSSWSISMIPTISYKILGVNGEVTDILN
GGIMIKDPSEDSATVHALCNELSTFGEGLIHSSASYADEGDFDKDVVAFNFECPEDKTSL
TSCKFETPFEVDPSTKKIWMKIFCVDRHQEFDLVNFDGQSVIVGQEPEWGLVRIISNHDF
NGNYIGFGGNQNLYIASDSPEPESASFKLFADMVCKSLGFSDSKERAFGRTGGDISETDY
CSDDFTCSSDDLDNQHCTTDFGQCGRRSNEYFLHILCQYKRQNLKITYTLRNAEHQRIGE
YGILFGRYTLNRDQQFGTICGKNFNSSTGENICKEMGYDFYVSYALNEGLIHFNDGDDFE
DTKIVVDEVRCNNDACDYIVRETSACHHTNDVLLRCGYNDDDHTIQFHLLSGDKVKSSDD
FSMNSGLLMAELRWNNKGKVGYREGLVCDDRLDSKTADSICRYMGFHKVVKFSNNRNAPF
LNDAELSENYVFLLDEVSCVPGADVTCTYDHKSNDCKAEEAVNLWCGYEEALCDKVELNG
YLKIACTHPDDPSRLVYRCPSEDLYYRVVESNCHSTRYSDFCRNDPHFYQVCGHRPLDCE
DEGIAVSSNILCSSYVCKAGLGVKSGNAIILSTRCNENLDCENTQVDEVICDEASEDDER
LCYNSDGVHYTEAEECNKKCDCLWCDDESYCNGHRYGAKCQHPLAHFHGIGDQDFIPRTI
PPNWICDGTLDCANGEDELNCGGSDAALRSDLKVCYRNGKNSQIQLNALNKCSVESELFG
KVCSIDEFYSQYNCADDDLEVLKCLSHGKSVTVSAHYVCSDRSSTADQLCDDAIDKECDI
PESNCVIHKHQNCDDVVDCTGSADEKRMLCEKMTSTVTCVRKYVGNGDEPRNIPYSWVFD
GVEDCIDGTDEEYDYFPKTCGTGNEKRQVEEGKNCGDLDLASFKCFTTNVYIDLSYVCDR
IESCGNENLICEVSRNVAVVFSKVLEGPNKVKQLSHCLPGLKDLAFLKRGCIEEKFDHPF
PLLGIDQELIHRPAVGGIDCRSVFGELYVYLSCSGLCADSPCPLQLLGDSTSCSNVFDPQ
MKPLMALTPDLIKTSKGFMWSQKGNTYLQNNLFRCDNGLCVKYNQVCNLVDDCGDESDED
KSICNNHFQCNNGDFIPSASKCDGRTDCLDLSDECNTECTKDIVDQIYLIMVSWVIGILA
CLANFIIIAKSIYEFKSIKTAAAMMNKILIFFISIGDFLMGVYLVVIGFISTKYRLSSDE
SEYCKAEFVWLTSWGCATLGVMSSFGSEVSLISMTVLSISRLLGIRSVFAPRHLSAKVRL
KLFGMILSIVTLSVLIAVLPLFDTFEDFFVNGLFYYNVPLFIGAPGIEKHLSILGKYFNI
RIWPANWYSWDSIRPLVREMFSSYSNIVGKKQHFYGNDGVCLFKFFADRDDPQATFIWAI
LGFNFVCFVIITVSYIFIHFFSAQSTKSVSSSNGNKEMQKRNQKLQRKISLIILTDFCCW
IPLILICVLHYTEVFELSSLYPFFSTMILPINSVINPLLYDSTVTDLVFKSFIRLRRLFG
GKDSTETVNCTSAMILSNKSLGETIPMQPLSGSSSVRQSAAPPSLQKRITGGVRHPQNSN
LVFDVTLEQNPTANIETQESDLKVEDGDRINKTVQIPEEVKVVTDLDSTDNQYIKD
Download sequence
Identical sequences ML07013a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]