SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07086a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07086a-PA
Domain Number 1 Region: 621-792,877-986
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000494
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 548-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 585-617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML07086a-PA
Sequence length 1069
Comment pep supercontig:GCA_000226015.1:ML0708:56938:60727:1 gene:ML07086a transcript:ML07086a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFSRTTTNAIALTLLALFAVKTGEPDSCEIAEVNGFLKRRCADRFGGVIMERQCAFSE
EKYTVYENFVSTICSNDTYGYQICGIQVTNNATFSSTSWSLCGFLYCGYLPQNLPYQKAE
LLCQEKCNNIGPDQRSLMGCRGDEKDSPNLPDVNQRIDGKNVKICDMMCDAWNCIDESHC
NGYTYGKICMSTEDGGLIINPPHELCDSNRDCMFYGFDEQDCGSDVPGLTYCVSRSFSVK
NDERRLIPMWNYTRCAAILFHPDNAIVPFVYNRKDIYQGEGTYTSVPYCIDFLDQTNCTD
ETRAALCHGVEDCVSGADEKHPWCQVMTEKTCYRNYRSNKKLPIPASWLGDKMMDCLDEL
DENWDIECGHSPATKRNEVVDVCEDVFLCRHGDVKFIRLTQLCNGIEKCSSENHICEIGR
GLTSISTFIPTQATETKSKTISFCVRGLGNLANQVCPCVTQEFNPFNEEVFGMDGRIVVS
LPLKQADCRFFFGEPYVILSCIGMCGNSECPLRQPIHFQDCPRQFSQPIYTVVNRKRLTF
VQRRAHDYHNDFFVCKNGIVCIDYDKVCNLWDDCGDGSDEENCSNNFICKNNQGILPLSK
KCDGHPDCWDISDECNSECSKNIINQSILKGAAWFIGLTAALSNVIVLFENLCSLKDCSS
GHTLANKLLIILIGIGDFLIGAYLLFIAVADSLIYGETYCSRRFEWLTSMYCSSLGVLST
FGTFLSLFSLTILSIIRASKLATGNLHRRPGSSKLTRKDYIWVVALMMLVTASATTMSIL
SLFDVLEDFFVNGLVYDKSIKIFHGQIGKEKHLKVIQSYYGRSRNQELSWRLIQSLIRFM
FSNDYGNLEGKVFRVDFYGNDGVCLFKFFVTEDDPQRVFSMAVLSISIFCFAIVSAAYIT
INVITFKSSRSLVVIKGPTANVVKKRNLRLQRKIATIIITDFLCWVPFVLTCFLHYFGVL
DATSQYGLFSIIIIPINSIINPFLYSELMHECASKIWVSTSSFFATVLANLHNKEKYAPD
ERHEERSEDHSIDFAPGKSYKVESMQMKVMSKSSKNDDKDVHQEVECGD
Download sequence
Identical sequences ML07086a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]