SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07241a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07241a-PA
Domain Number 1 Region: 776-1070
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000796
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number 2 Region: 719-751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 343-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000812
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML07241a-PA
Sequence length 1107
Comment pep supercontig:GCA_000226015.1:ML0724:4245:11647:-1 gene:ML07241a transcript:ML07241a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMTYLQEELINTDETHWNWTTVEQDDYIPYDLEGFPLHIRAEQAVVNKTKILISFVTSY
HGFYVSDKLEISLQEDLHYSMECTGWTKISLVTRNISKQESVNLIIRKSATSIVGFLDGV
KIIDFVFGDHGSDCQDFWTQNIAWIRFRSISGMEFKPHVREIGRNCSIEEVGKSEPKFLK
KVCYYDNLPWYQCPNSDQYYGVIQDSGSECSLQLYDKACGNDPKFYQACGHNGCHNHQQG
KVDHKDHPLLCSTYICTSNKMLGTNYGSLGGNMIESRIDCNGVLDCANTKIDEDYHCKDR
QTFTCRENFGTDTQIEEYKVCDNSCDCMLCSDEGQCHNMTYGVWCNSQYGDFIQSKWVCD
GIADCTEGQDESKEVCSEQNIVRTCNYNNIVKPLTELHICTAPTGGEYLCSDGMDQVNCS
DASRVALECSVKGHSTTVSVFAVCKGFGICDDKYDDQCEQASPECFLHTNLFCDGKPDCP
GKEDESDFFCARISDVMCTRRVSMSQEKRKLPIRLGWVFNGIDDCIEKEDEVSSYWQKCG
DGPTARLVEDSTPCQEVFICPQKKGVYVHFPSFCDKKASECGQENDICEKARKHMRLASK
MQHYDGPQIAMSYCLKGLESIQNQAGICLKSFEFAVNGSEAIGANKFRVDMPKRPSTCSA
LVGKAYVVRSCSHLCSDTDKCALSEIPDSCLNIASYRTFSLTEKNQLVPLIKRKSEYFFQ
TFACSNGRCVDFDEVCNYVDECGDGTDEVGCSNSFYCPRHKEYISISSKCDGHVDCQDYM
DECNSDCPSEKQQILGNYSIKIICWVVSILAVTLNSVTVVKAAIDLKAARWYRKALTNTM
ILLISFGDLLMGAYLLAVAIADLTYGTTYCFEQYLWLTSSTCAVLGVVNTVGSQLSLFAM
TALSVFRAGVVRSRAMVKERASTKLSRIKLIVFPLAIFLTSLAIGYGPLLNTFEDNFVNG
LYYHQNPLFTASISKDTHDDIFKVYFGRYKSKQISWEDIRHLTGEMFTSEYGERINATSW
YTKFSIIILPINSIVNPLLYNGTIQDFTATLYKKVLNVAFSKVEGVSLRMCTKRRPSCRL
ESPQENKKDNNEREIMELIQLAKDIEH
Download sequence
Identical sequences ML07241a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]