SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07302a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07302a-PA
Domain Number 1 Region: 261-396,474-590
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000613
Family Rhodopsin-like 0.01
Further Details:      
 
Domain Number 2 Region: 3-25
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML07302a-PA
Sequence length 642
Comment pep supercontig:GCA_000226015.1:ML0730:4543:6471:-1 gene:ML07302a transcript:ML07302a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCITIHQVCDSRPDCLDLSDEIPCQDFQQCMRSLRPEVETDNVTLDDTSSLRNCNRSLN
SSKSDEILKLETIFFEPDVIKALLAANNYIDLGEITPSLLEDCQENNTALGFHCNRLVLM
GSESAYKCTENSSVEALYKTYLNEHELISPYQYTFVFCDGITNCKNGIDEQNCPGTFYCR
SDGQPVPQERTCDSVSDCADSSDECLNCTMSSVFTSQTELIGHNVMLVIVMAEIIGILIL
NIYGLLFHGRRFRDASRSFLQIDIIQCITLTVYDTMMAVFLLIICWKHWEYQGDYCSHDV
SWRSSSLCKVAGAIIYTASHGALQVAVATSICRSYTCRNILSGKKIKLSRFLLCSGLLNI
FNLSMAVIPLVATFSSSSSWSDMFVHEFFFKNNPLIRRGNRSDIAALVSLYKGETLNMTT
EYSVSELFDNLRNMTAKGELFSPERTTSIGLYGTSSLCYPDLFSVENSILGFKIVYMVEN
SIYMIVIIICYGIIVKEYFKSQTAVAPPVKANKEPGSHDKEGTNQNKNTDQGFYLSFKVC
IVIGSQLVCWMPVHGAIIASFTGTPPPKIITDIFIANIAPLNAIMNPLLHTDLLTKLMTK
GMPLFREKLFCIKKSIGRLLCFNNSVGPEAQKNTDTEMRNMD
Download sequence
Identical sequences ML07302a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]