SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07453a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07453a-PA
Domain Number 1 Region: 179-275
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-20
Family I set domains 0.0093
Further Details:      
 
Domain Number 2 Region: 570-662
Classification Level Classification E-value
Superfamily Immunoglobulin 7.92e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 752-808
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000732
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 4 Region: 649-750
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000252
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 811-899
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000522
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 2141-2191
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 7 Region: 453-511
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000419
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 8 Region: 1765-1859
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000159
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 1475-1563
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000328
Family I set domains 0.02
Further Details:      
 
Domain Number 10 Region: 1072-1165
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000038
Family I set domains 0.022
Further Details:      
 
Domain Number 11 Region: 1667-1759
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000447
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 1989-2084
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000622
Family I set domains 0.048
Further Details:      
 
Domain Number 13 Region: 355-408
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000785
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 14 Region: 511-565
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 15 Region: 1569-1661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000146
Family I set domains 0.015
Further Details:      
 
Domain Number 16 Region: 1226-1293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000173
Family I set domains 0.015
Further Details:      
 
Domain Number 17 Region: 279-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000409
Family I set domains 0.038
Further Details:      
 
Domain Number 18 Region: 2089-2136
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000128
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 19 Region: 412-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 20 Region: 1033-1067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 21 Region: 992-1025
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML07453a-PA
Sequence length 2484
Comment pep supercontig:GCA_000226015.1:ML0745:19943:41961:1 gene:ML07453a transcript:ML07453a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTITFRITTSNSSHETLNKIISSGASDRIFVETVENDGLYTSTLTLRSVDETDEKVYSV
ILTSSNKKPVLATASLTTTQVPEIVSDVTSVAVEEGDDILLDCEWTVFTPSGEPGPPAPN
PAVWEPGLGTRPVPTQLPHMEVEIVVVGTLSLTRRSVSSLTVQIESRTCNEQDCPEHPIV
FTMPDQEVEVGDRVEFVCRIHAQPRPSVIWMRNSEQVTSGNKSVITNKSMDDTTLISKLV
IPSATVEDAGMYVCLATNVAGSNIENAALTVNDPNEDIPVTAVSILEGDSVTLACVAAGS
VSWDLDGVPLSPGSRFVFVENNLVISDSTIYISGIYTCKEGSTNRKRYDVKITAVNGGLS
AWEPWSACVGVGCGVGQRSRTRQCNSPTPSSNGVDCIGDLEEKEDCNIPCRSEWSDYTQW
SECSADCGGGFQSRTRVCITQGNNGTCTAPGPVCPTHGKFGEWSGWSSCSVDCGRGVKSR
ERECDNPAPSDGGRDCEGSSMEFAECIKPACDEEGKFTEWNSWSECSADCGAGTQSRTRE
CVSKRKRRVESVTCTGPLSQVRVCDKQCVEITSPPESISVNKGETATLNCEVSDGEVIWF
KNGEEVLEEENIRIYSRQGRSRLQISDLVRSDEAQYTCSVTVGNKTDRATATITVLELPE
ITFMSEEQRVREGDSVTIECVARGVPAPGVSITKYEDLQVTPTPKDPEDNRTSEVKETLK
ILYMTPEDEGEYVCTAANDRGVEEKSTAVILVVDGSWSAWSDYSECNVDCGTGTRARTRT
CSDPSPRNGGDSCPGSDIETSPCTLDPCDFAPVFVVKPTNLRVTAGERVEIPVVVNAQPA
AEVFWLTPGGPAEMLEGFQVIPENTTLVIEEADLRDSGVYKVLASNDEGVAEYAFTVIVG
CHLTEASRTRGASWTPATWTPPWNTNWSEGTGGWVTDCWSGMTGWYTDWGWGTTDWGWGT
TDWGTTDWGWGTTDWIWGTTSPPTDDYVTGEGDYYCHGHGNGHIPWYWVCDGIIDCPYED
DEAGCDATPSTPSTPDDFYCYDGSVIPENWVCDHISDCEYGEDEAGCGEGKGPVFVSGLQ
NVTVTTGTALQMTVTSTGNPLPRIEFYRTLQGVPVKLSAQTMTRRSDLIGSRYSISVVSL
SDEGEYFATADNEYGTAVTKGYVKVVQGLLLSSEISNLKRCDKYRLSRTDSALTVPVLTG
QNLTLKHRFPFSHLTTSDVVPAQVSILVPNPLKVIYGDEVRIPVEVSGVPTPTIYWDTPA
GEVVEKDDGSLVIPFVLPEHEGVYTISANNTADGEPETESIRLVIGQADIDTSLLDNSGV
YTLTAENQHGEAEEEVEITILSDTSGPKFNSSVYSLQLFHGQSGSIRLGVSGKPLPIITV
QPARDNVEVDGDVVSFRRVTPESVSAFGLPAPEMKISRVTEESEIVFKPRVVTTGTTSTA
SFTLRNPEVYSETFNHSACIVFDQSMSIFNVSVEPEFVFGIQDAIINQGEDHQVTFEVSG
VPDPKVTLTKDGVPISFYTEPTEDGLKYIHPIENASPDDAGVYRAVAVNEVGTAVSAAEI
EVKLRRRAPQFTQVPRDSMLQPGDDHEIVAEVTGVPKPNVYVTDEDGRVVGDGKIVEVDE
ETVRFSLDLSDIQPADAGRYTITANNGVGRPAIHEFELEVKLEDREPEFTQVPRDVTLKT
GDDHVIAAEITGVPKPNVYVTDKDGNVVGQGEVEEVDEETVRFILDLSDVQPEDAGRYTI
TANNGVGRPAIHEFELEVELEDREPEFTQVPYDVSLATGQDHVITAEVTGVPKPNVYVTD
EDGNVLSGGEIEEVDDKTFRFSLKIPDVQEDNSGRYEIIADNGAGNPASHVFNIEVYEFS
TSTPLTIQPAELNKVITIIEPLPAEIYITKGDDVDLSIKIEGTITTIDSEDELEVTLVNS
LRGLETDLSKHLQWELIPDEKTADQYDIEATLPYPYSLNAGDMRLSVANQHGGDDTQTVL
NIEEMGSEDPPYFDPAPTDIKTYPNKDVLLETRVRGSRPVKIDWFVTKPGSKTPRPITGD
GEKYQVHINGSLSVLDVGDEDEGVYLVQVSNSAGSATEEAEIEVTHSAGYSDWTDWTPCS
ADCEGTRTRSRFCNNPPPTPGYPSCPQDIETETERCGADRCPGFSTWSDWEECSKECGYG
TRTRTRQCDSPPPEIGGPQCEGLSVETKVCYIKKCPKRIINFCNTPTPKSTETGVFGADG
ATALFPAVPAHNEDPELVPTQYPQTVEPPVKVPVTSPGHVSSRQYARGSLCWIAGTRGAS
VRLLAEEELRGGLEDSVRVSESPKSPVSIRLEVGETDICLSTKMMIGKSYSLVDTDTAQI
YGTVTKDGTYSSLTLYSRRSSLTLENLDSNLPSNVGAVIIRRKNNKVVLKGDLFKLDVVQ
SKDGGLMVQIVQLDPEATGLLGLLNSVNNSSQIVEKSGKKKILRHDGINYLLEKSKKQSC
FELSNEKYSSRILGSINNFLDNES
Download sequence
Identical sequences ML07453a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]