SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML076912a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML076912a-PA
Domain Number 1 Region: 740-924,1011-1116
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-18
Family Rhodopsin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 658-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML076912a-PA
Sequence length 1196
Comment pep supercontig:GCA_000226015.1:ML0769:93555:97145:-1 gene:ML076912a transcript:ML076912a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATECDPSGERPCCMNAWSFEQHGVCGNTTEHCTCVGCIDYRIMYKDWTESGGRVKWRTG
DGQCGYLKPLPDGTPTECNPGGEKPCCWSEWCGRNTKFRECLEGTDYRVVREIRESGQNC
IVTRLVSGFLKYACFYEPTSRIYFKCTHSDVFYAEHHYGEYNTNNIGVDNLCLNDPYGYQ
VCGFDFDLQIQNKDVLCGGYICKELYNHKYVACVGDECKEENRDCASTKNDLDQIPCDDK
CSFKSWSCEDERYCNGYQYGFKCDHKFEVDHNGLKEIPTWMICDGFEQCLDGSDEQICAV
NISSVHSCTHYRNQVDFNRIDPVPIHNFTRCAVFDLKMRDANPYCYEYLDQTNCSDIERV
GGYCKVEGFMSSVSRYVVCLEYDQFAGMPVKICDDNFQNNCLSPSDCRIHKHKMCDGFID
CSDGGDEIHDMCELMSNMLNFTSCKRTFHPKLGEYRIPVSWIMDNEMDCINGEDENQAKW
KFCPGKIRKLSLPGEGCRDVYKCPRGDKSTVEFDLLCDGVESCDDGGENNVCRIARDFPV
INKISTISGAIRSVCNASISTCEVREFTRPWGEVFGEEKIILHVPNSKVNCSRLFGEHYL
FLSCMNLCEESDVKCPLENGNRILEYNSCRGQYPNRGYTLGNNSFLTFLDKSEGGLYHQD
FYQCDNKKCVEYQQLCDLVDDCGDMSDEIECTNHMVCHNTLDATKRQFISLSQKCDGLYD
CFDLSDECNEKCGKEILGNWPLKILCWFMGILAMAFNSFIVVNGFLALKDCETEQMMTSK
VLMNLIGSGDFLIGLYLVILSVYDGIIFGKDFCKQQAVWFTGTPCSSLGVISTLGSQISL
FTMTVLSVIRVYGLTCKPMRIPGPVNKKSILRVASLGMVTITAALAIAVTPLLPSLEDYF
VQGMYYDPSYKVFIGFPNKDRHINILQSYYDQNSNTTENVSNVSTNISTAMSWKEIGEKV
DGMFTHDIGNLSRSPVHFYGNDGVCLFKYFVRTNDARRSRQSTDQINFTGDPVVWIMLVV
NLCCFTVITFCYVVIIVKTKKSSQKSGQHENQERQKNERAIQNKIMMIVATDFLCWVPFI
IISGLHNLEYIDASTWYASFAMTVLPLNSVINPLIYEKALGELIDRSFRRIKAVITFGGR
SVLAAFTGMFQNAVEQEPEVIAIDCVNHDRNMDTGRRRYNEEKTFETSQTAIETSD
Download sequence
Identical sequences ML076912a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]