SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML077638a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML077638a-PA
Domain Number 1 Region: 673-807
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000351
Family Fucose binding lectin 0.0089
Further Details:      
 
Domain Number 2 Region: 1416-1540
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000119
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 3 Region: 632-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 1244-1279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 315-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML077638a-PA
Sequence length 1566
Comment pep supercontig:GCA_000226015.1:ML0776:358446:369752:1 gene:ML077638a transcript:ML077638a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVLFLLSVFFIAVSATEGWTIVGTRDINIDTSLDFTPVQVRTDSTVGSGDILWVRFVEH
STNNGPGIKMVFSDPPIYSLGYCADNIVFTMCAGSERVWTISKGNGKIKLECDGEVIFDI
DYATSTNSLCKYFWSLEFGQMRFQGGDSASDFYRSYSGAVLIDSDVRQPANDWTVVRTKD
INIDISLDASPVQVRTDSTIGSGDILWVRFVEHSTNNGPGIKIVFSDPPIYSLGYCADNI
AFTMCAGSERVWTISKGNGKIRLECDSKVIFDIDYATSTNSLCKYFWSLDFGQIKFQGGD
TASDSYRSFVTNTGCTQYDFSCADAKHCIGIDSVCDGNIDCKDGPDEEDCVDWTVAGTRG
SNIGISLDASPVQVRTDSTIGSGDILWVRFVEPLTDNGPGIKIVFSDPAIYSIGYCADNY
NQFTVCAGSERVWTISKLNGRIILICNAEVIFDIDYATSTNSLCNYFWSLYFGQMKFQGG
DTASDSYRHFSDWKEAETRDFNIDISLDASTSLQVRTDSTIGSGDILWVRFVEHSTNNGP
GIKIVFSDPPVYSLGYCADNIEFTMCAGSERVWTISKENGKIKLECDGEVIFDIDYATST
NYFCKYFWSLEFGVGQIKFQGGDTASESYRSYVKVWCTEYEFRCVDARHCIGINLVCDGN
IDCMDASDEEDCEGRNIAKYGTVSQSSVAYRGVPENAIDGNRIGRHHVKSGFGFQNKNSK
EWWKLEFSTEVQVDFLKIWNRLDNGGNFENVIDGVEVYLDNTLCGVIEFVSRKNPYRIDC
GLQFVKNITILGNNDLTICEVEVFSQNPPETENLSCEYQRRSKICNEICDDEVNCVDEAE
CNGVRYGKFCKLGNMYYNILLITVMDWLDWNYDCQLWAPYNTRQSYLEHHTGQSCKHSLS
GVETPIFNFTRCAAIEYAPSVIEHEELWWLDTTKATYCENMMDQTNCTDFSRVALSCMVA
GYRTNISKFVICHGRADVTICDDGIENACRHLSPSCFVHKHKICDEINDCKDGSDETAIE
CKELTDRKCSRVLGNKRIPIPLAWLGDGVEDCVSSEDEKPIWPTCGTGSTLRYVLGNESC
TDDFLCLNSDTKFIPQSQLCDMIETCGNENQICKLARRKTELFTTMIKHEESEERMVPGC
LKGLSSLQNLDSQCKRSTFSFPKGKSFGVSNIKVVTLPQKIINCNYSFGEMYLFTSCSGN
CATSQCPLKRPLKFDSCGGQYKNRVFTVHNMSYLTFVTPRKDSYHNDYFLCENDKCITYD
KVCNLVDDCGDGSDEDSCTNHFKCNSSGARIPKWQICNGQIDCEDLTDECNSDCGQEIIG
HMALKIFSWIIGTSLAIAILPTLPQFEDFFVNGMRYEKTNPLFVGLPDKKVHRQVIEAYY
GRTRGEKNSMSWKTILELVDGMFTSTYGGISRQKVDFYGNDGVCLFKYFVTDEDPQRFFS
WTILGINFFCFSIISISYIIITILSIRSGKAITNNRQIEKRNRKIQRKITCIIATDFCCW
VPFIVICCLHSLSILDATPWYAFFSIVVLPINSVINPLLYDTTVTRQFGRPIRKVSTMMS
SFSGSS
Download sequence
Identical sequences ML077638a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]