SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML07809a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML07809a-PA
Domain Number 1 Region: 108-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML07809a-PA
Sequence length 707
Comment pep supercontig:GCA_000226015.1:ML0780:106298:108605:1 gene:ML07809a transcript:ML07809a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTANKIMNPYFQSKYFSIDFFLTALFEDQSCTDLTVNGMGISPAIRSFDIFIRNSASYE
RLMTMGADQTTQYIMCLRDESEVRRNTCAIPDSWQCDGFSACLNDECDCDKDSFKCADGK
GCITIKQVCDSRPDCLDLSDEIPCQDYQQCMRKLRPMLNQDVDTDDSRIAPNCNKKSNRK
IEDDEVSQLHKFFFGPEGLQARLLDNEAQKSSYQISSTRLAECRDNNIALGFHCKRLELI
KSEIAYKCTETSSIEAMYSYANITNSSTFVFCDGIKNCKNGIDEHHCPGMFYCVSDNQPV
RKERTCDSVADCADSSDECANCQMSSVFSSQTHLVGHNFMLFVLMAETCGIILLNSYGLI
YHGKRVKNVERTSLQIDIIQCITLTVYDIMMAVYLLIICWKHWEYRGEYCSHDVYWRSSP
LCKIAGAIIYAASHGALQVVVATSLCRNYQCRNVLSGKRIKLALFISGFTVLNLFNLAMA
IIPLIATFSSSSEWADMFVHEFFFKNNPMIRRGTKSDLASLVSLYKRQETKITTEYSTPM
LFQQLRNMTAKEFFKSRKAVAAPPAGSPPVAGQEDSNPKKSLDQGFYLSFKVSIVIGSQL
VCWLPLHGAMISSFIGFPPSNIITDIFIVNIAPLNAIMNPLLHTDLLSKFMNEGLPLVKG
KISRMKEGLSRLPYCNKAISPRSDEQENIEIASYEKNVGVGEGVCEE
Download sequence
Identical sequences ML07809a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]