SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML078921a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML078921a-PA
Domain Number 1 Region: 13-331
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-19
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 2 Region: 1063-1227,1313-1419
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000256
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 3 Region: 988-1022
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000524
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 602-625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML078921a-PA
Sequence length 1516
Comment pep supercontig:GCA_000226015.1:ML0789:140589:149235:-1 gene:ML078921a transcript:ML078921a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNATLADSTSLIEGMDIFLGCFTFYCLIIGTPANIYSCHFFSRHKSAQNQQQSATFSVY
SIIALTDSFICMNGCAVGVCLLNDRDPTVFDSFTFRQIWGTVNRTQAAFYLFLVLVINLL
RMVKVLFVHKIIKPRLIKVAMISYFLFVLVRTTASNIFFGQYTMGSTIWQENGHHCFPTQ
NTLDPGHILVEVVFVSINIALPLLLIIGSTCVTVTVILHRRNAQARKLRNATSRGGASRD
VTSRATVTVLIFTAAYLFCNIPLSVTMINVIMSVYFSQAGASSVFYDEYARMLTFILLFQ
LNSAVNPLLYYLRIKSFRDKTRDVIGRFTTETTSSGTEKKTRPAEKGTVSDLTLPAEQGD
ETGATQQTSVASTSSSEFSVVAATDFTMVPVHDIGGDEEDCRFVEYYGYIKIQCTAKNKI
ENEVVTYFKCPNSEVNYVVRRGCKRQNDQKVIRQQFSAACHNDPKFYQMCGIMELECENY
QSNKGEFTAIEDMHYHGKFLCGHAVCDTGRNNRVYGTDFECDEKCVNIPQSADQTCTKSN
KTDTFACMDAPFESSHRAEVNVSKVCDGACDCPYCGDESSCNGYQYGHYCQMATLYSDPE
LFYLPLVALCDGTPDCADGSDESNCDENTFPTCTGRLQVFNSETQNYTEESVVRIITNRT
RCAPFDGRGRLPFCDDFSDQLDCEDPSIAKLTCQRDGYTVTVANRMVCYDDPDVLPLCDN
GLDRLCVTIDKTCTVHKHQLCDEQEDCPNGADETHVTCRDMSNHTCKRTLGGRVLRLPYS
WIYDSYEDCETGADESESYPTCGETPATRRLKKTEDESCQEVFLCGHPPSDHIEFNDLCD
KINTCDIENDLCHVALDTPQISQYIAKHEEKLVFPFCFKGLGKLAEVIGKCYDTKHTGFH
GTEVLGRTSQVLRISDTTFDCNYLYGEAYVYMSCIGNCSSSETKCPMQTALKHDSCPGQY
QSCRVYTLANNDYLTFLLPGGGGKDQYHNNLFSCRNDKCISYDKVCNLVNDCGDFSDEEL
CTNHFKCASLQDYIPLSSKCDERVDCQDFSDECNDQCSVRIIENVALEIAAWILGSLATL
FNSIIIFRGFPPLKKAYSSGVLTFSMRVFILLIATGDLLVGLYLLTISSYHHIYYHRYCA
ERFEWLTSLSCAVIGVVSTIGSKLSLFSMTFLSLMRALRMSKLSVGSRKTSKREVLMVLL
VGLIVLIISCSIAAAPLSEHFEDFFVNGINYPGNPLMGMVGSVTKAKHFKIFDKYYGRLR
TKDLSWKHIDKLAMGMFSQEYSESGIPRNQVHFYGNAGVCLFKYFVTPDDPQKTYVWCVL
LVNISCFAAITIAYIVIQYISNRSSAQVTQNQGNKKLTRRNQKLQRKITLIIGTNFCCWI
PFVIMCCLHSSEVINASRFYSLFSLIVLPINSVLNPLLYDDTIAALIKKIRKRSTEQVRS
IFSGDTTGQDQVVERRRRLLKITTSKTQTFFNDFIPLREAKQAVKAETIAEENSTSSGRV
KTNLVRFNVLTETVKS
Download sequence
Identical sequences ML078921a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]