SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML08661a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML08661a-PA
Domain Number 1 Region: 115-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-34
Family MAM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 410-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-24
Family MAM domain 0.0067
Further Details:      
 
Domain Number 3 Region: 320-407
Classification Level Classification E-value
Superfamily Immunoglobulin 4.44e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 4 Region: 278-316
Classification Level Classification E-value
Superfamily Trefoil 0.00000017
Family Trefoil 0.0026
Further Details:      
 
Domain Number 5 Region: 79-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 1-74
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000396
Family MAM domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML08661a-PA
Sequence length 574
Comment pep supercontig:GCA_000226015.1:ML0866:485:4107:-1 gene:ML08661a transcript:ML08661a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGQDVGSLDIAAEYGNGTITSLSKLDGEQGQAWMLSSSSFPSTTEGIRFKITGTRGPSY
MSDIAIDDLSVGNCAVQNYCPTDQFSCLDKPHCISHDLLCDLNSDCPDNSDESRHCGACD
FEHSRCDFVGSLGLTSWKRTSGSTWAAGTGPDTDHTKGTALGYYMLFSASYLSPGTSAFI
QSTTYPITSTECKLVFYYHMAGIDMGRLSVSVRSTQSDDMFVEVWSMEGHQSNKWQRAEV
PLASLANVQARWKAVRGPGVKGDIAIDDVSYENCGVKTCDVPPAVQPSCGTPGIGQKECE
KLGCCYREKMCYQKLGITDPAIVVAPTPYTGDESDVVTLICKATSNPNPRYSWSRTSGEP
LDAARTTVNQDGSLVIIDASYYDSDTYTCSVTNGLKTVNASAKVEIHAGGANFDLNMCKW
HNVHKGDKWDWARHYGYGPNFWSGSGPSQDHTTGRGSYLLLDTGDDTKKVGDTAIVHSTW
LTKGSNREKRSAAGSCTFSFWHFMKGSTVGSLTTSIIGADGNKQVLNTLTGQQAPQWTFQ
SVPIPSTVNIFKIELTASVGGNKGDIAIDDLKFS
Download sequence
Identical sequences ML08661a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]