SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML087111a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML087111a-PA
Domain Number 1 Region: 374-562,617-741
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000439
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 122-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML087111a-PA
Sequence length 802
Comment pep supercontig:GCA_000226015.1:ML0871:85597:88005:-1 gene:ML087111a transcript:ML087111a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWTGAILILVAVNVHTNKHCVDFQAVLLNQWSFMGASYIPPCSMIQFSRLAQIGSENTG
DLNTCRFQPSLNTCFNLSLSSHDSLPECLSDSWHCIIPKFEVCSGRSICLSDECLCAETG
TELFFCGDGQGCLTLNLVCDGKYDCLDRSDELLCDEVVNLTCSNSGLKIWPSDITISISR
FIPCSNSWISSETYASLYPFTDCDLSFCNDIDIANSKVAGYERFEDCLNILSLTSLEATD
DLEKWLNLNLSSVCLDACKDSASKEVCQKIVSGKEVVTPGRNFEFRCPTNKINETQNDEQ
YLDMKSVCDGIFDCADKADELFCLDRLYCSKEDGNTSQVSWVSPEARCNSYKDCENGLDE
CDNCTDSSLSSDQFIVRNRAIFAWLIVSCLGNLILNVYLFWDNIKSEFSNQQNYVKVDRI
MKLQICVYDGFLGVYLFAVVIANVRYWGKYCLFDDEWRSGLICQCLGMLFNFSSHGSLFS
VLLMSLTRAYKCMFSYSRGIHPRKVVVLSILIATFNLAHSIIPAIPAEFIQNTFRIKLTM
SQLNPFIMTDFDNISHVDRIYFQYFGKQETEVGLYKKLDELKKITNNPKFFSYRELSFYS
WSPVCVQDLYGYRESLEGYKGCYIAFIITILITLSSSYLKILAVFLESRRTVNLQGNEAD
SENIIILKVSFIIGIKLISWLTIIGAMTYYHLSRKNVPDGWFEATAICIVPVNSIVNPIF
NSEILKHAENFFRDKFCEKRQQSPALIMIPPLQAAAEVIMNPQSLADAVLENADREITNS
GNKEENGESNDEDLVTIPLELG
Download sequence
Identical sequences ML087111a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]