SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML09082a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML09082a-PA
Domain Number 1 Region: 811-994,1077-1182
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.49e-18
Family Rhodopsin-like 0.0052
Further Details:      
 
Domain Number 2 Region: 731-764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML09082a-PA
Sequence length 1261
Comment pep supercontig:GCA_000226015.1:ML0908:12517:16473:1 gene:ML09082a transcript:ML09082a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWNFLYVLLLSSWSNICTSSNTSATILVGNKWKDNTAAPILVQKKWRDDGKCGSYNLLE
DGTPAQCDPDGAAPCCDNTRGYGYCGYGKSYCSCFTCEDYKLLKDWEESGGTLKWRHDGL
CGDGNYLPDNTIAECDPDGKKPCCFLDEKYSFFGECDGSSPVDCTCRNCVDYRLVKRVRE
VRTDGDCALLRLDSGFLKNVCFHETLKRLNYKCINTDVKYKPLYTVEFLMNLRGVSNICE
NDPYAYQACGFIRTPITNTEVFCGGYICDKLGTIPGKYIECTGDTCRTENRDCDTSLDNP
DTSLCNDRCEEESCEDESYCYGYKYGLSCIRDTHLHYLPVEMICDGGVFCDDGSDEHDCT
VTNSSVQTCLHARVEGLLVPILNYTRCSRFDVDNRSPTLPYCRDYSDQTNCSDPQRVGGY
CSINGVLSSVSKYVVCYEHNQTIIKLCDDNLQDNCVATFTNCTLHKHKICDETKDCYDGS
DETDDVCKTLTGETEFTCIRRFNPNKGYMSTPVSWIMDGTADCMEGGDENSTLWKVCPGE
FKKVILPGDICQDVYRCPGGDRPNVVFANLCDGVESCGDGAENDVCRVARDFPVIQKTAP
YNGSIRDVCSTVRVDRSVTCTLKEFPKPWGTSDAFGVITRKQLVFPTLKVICSHLFGENY
LFLSCMDLCLEENIICPLDNNNNNNSINNNNNNNNVLSYDSCPGQFPNRAYTIVNNSFLT
FVDSDDSIYHQEIYQCNNSRCVEYNQVCDLVDDCGDMSDEINCKNHMICEDSLSLTKHQF
ISLSQKCDGIYDCFDHSDECNDSCGKEILETLALKVICWVLGILATILNLYTIFRGFSTL
KRCETNTMMSSSAFMILIACGDLLIGVYLVFLSVYDSVIFGKEFCRNQAEWLTGTECLIL
GVISTVGSQISLFTMTILSIIRMKGLTQMSVHSPTNRTSFVVIISQVFALFMASLAIAVT
PLVPVLEDYFVQGMYYNHTYSVFIGFPNKDKHVKVLRSYYSHNITDKAVNISTTMSWREI
SEKVDGMFSQDFGRLSRSPVHFYGNDGVCLFKYFVRTDDARRSRIETAAESTDFNGDPIV
WAILVLNFSCFIIITCCYIVITIRTRMSSQRSGQQDNRDRQRSERAIQNMITVIIATDFL
SWVPFIVICALHNLAYIDASTWYAPFAMTVLPLNSVINPLVYDRTIVSAMTGKFGKFKSI
LEHSVVTRRLFVTRVSNLDEIEMNTLDPTHVVEGVGNSSDERDNVFESNGYDESDRFSTI
L
Download sequence
Identical sequences ML09082a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]