SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML096816a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML096816a-PA
Domain Number 1 Region: 4-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000654
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML096816a-PA
Sequence length 190
Comment pep supercontig:GCA_000226015.1:ML0968:110732:111780:-1 gene:ML096816a transcript:ML096816a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKPCPIGTIPCNDYVGCYGFEDLCNGEFKCQDGTDEIAKGTCLNADNVKICLTESDMCD
GIRHCKEGFDEMSCGNPYILPTVVSLAAIVVIVVIMCAVYKLCVYRYSSSRVNNDQSTSC
STIFLKKHASETRIDIGQLEPSDKSSQQSEEEKHALHPDEEERCEQCVQYPSEGDDTSVG
SSSQFVSTTI
Download sequence
Identical sequences ML096816a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]