SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML102912a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML102912a-PA
Domain Number 1 Region: 778-948,1016-1125
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.49e-19
Family Rhodopsin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 689-723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML102912a-PA
Sequence length 1207
Comment pep supercontig:GCA_000226015.1:ML1029:151756:157782:-1 gene:ML102912a transcript:ML102912a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRVGLLTIPLLFWTFNPSRSGDMIFSVQSAGASSYKPLNDEDTGQRARDWKICFCDCHS
RKFNVDHIECGDNATNIEDCTLIGGKENTYCLESDALYVKCINDFNRSSNDWTVANIGGY
ITEILVNDSDVKDTSSYIYKCPFEEEYYKIVRKFPCNTYPRFVNDTTGYCYNLTKTCSFS
DSQLCGIDNITAKDGRCMVVCPITGVGESVALPARYICNGEEDCSNGADEINCDYRGSQN
CTLDSSIVIPRLTLQQVTCDESYFYCGGGFHYIDENNCNHTTGIRTGFSKPSWVEGDWWL
HPYFTCLGSHSMFWDQKGCEDPGGDLGGGEGIRCNGTEGEVYVPPFNMCTNPYINAPDST
TEYHPCIRWEEQMNCQLGKDNVALNCEVEGEMTTLSKYLLCGRGETCDDGMDEKCQNFTT
ADGELCSTHKHQICDGKEDCAFGREETDCHTKLFQQVTCIRKVKFDKSVSKALPILKELV
MDGVEDCVDGEDESPDYFQKCGKEGTDRYRNEIRATKCNEMFKISRIAEDSRYLNMDNLC
DHAPDFPEEKRMCFISREYHELWKKNVPYSGKVYLPPCLPDLLKYNNALFSCEEKTYDVI
GKNTSLHFLYSRTKQRCSFLFGEAYLFASCNDLCFEKDAICMEQNRNITECLNDDIQTIN
TLRKDRSTNKIEIVAATLSNRSGRYHELETDVFPCRNGRCIKKYEVCNLADDCGDGSDED
DCVNQFRCLASNERLTLEKQCNGVVNCVDFSDECSEDCVTTERRIISNSHLRNAAWTIGI
GSTVINILVLIKSGEKLRGMRGVSVVFRDNLMIMLIALGDLLVGTYLLLIAIADYSKGDG
FCKDQFDWRGGTECLYLGIISSIGSQISLFTMTVLSIYRVYRILHLFESSLLSRKRQILT
ALVCLLILVVSIVISVIPAMAAMEDFFINGLSYEGITLFVGTIDKPVHMNVLKQYHGQLR
IQYKDGLPTMSWRTIRRFIADMFSKDHGGVQGKGTGFFGNSGVCLFKYFVTDDDPQKIFS
LSVLFLNFFCFSVITVSYVIVLIVSRSNSNTRQVAQMNSALQRKISLIILSDACCWIPFI
VMGVLHFTRQIDASPLYDMCSIVVLPVNSLINPIIYHSEFREYVRVTTGFLNRIHDKARL
VFQFGRRRASESETAPESYLPTTETKATSGEVSSCKAETISLKTLFIPKQTLETRDESDI
TPCQEPN
Download sequence
Identical sequences ML102912a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]