SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML10613a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML10613a-PA
Domain Number 1 Region: 209-285
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000275
Family Scavenger receptor cysteine-rich (SRCR) domain 0.005
Further Details:      
 
Domain Number 2 Region: 317-393
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000196
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0047
Further Details:      
 
Domain Number 3 Region: 397-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML10613a-PA
Sequence length 462
Comment pep supercontig:GCA_000226015.1:ML1061:24834:30807:1 gene:ML10613a transcript:ML10613a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTAVLAAVLVASVTAQSDTSDGWTIPNKGSTQRIGFDFENNAIEVVTQNMMQNRELFA
MTWMSDTSVVGTIYIATLNEGLVVQIPECYGGSMQYPVPEGQGLFDSEVKIWNLARYEDR
VEITCNEELLMTIRFNEDCGQSWLNMPTSLQFENIDVASDGYRAVPKREQIPDGGNNNNG
TTELFTLVDSEGNEISEEGQLGLLLYKGGTVCDDSFDGLAAAAICKKMNFTGGASWTSEE
SFEIQSSYNINLDDVDCESAEWENCTFTEEDNCGHSEDVFLSCGEKRGSTELFTLVDSEG
NKISEEGQLGLLLYKGGTVCDDSFDGLAAAAICKKMNFTGGASWTSDESFEIQSSYEINL
DDVDCDSGEWESCSFTEEANCAHSEDVFLSCGEKRGCEEGTEACSSGDQCIFSQWICDGT
ADCDDGSDEAYWRNCEDRWNAGTRVWISYLVMLVSGFIAVVA
Download sequence
Identical sequences ML10613a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]