SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML11228a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML11228a-PA
Domain Number 1 Region: 126-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 166-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML11228a-PA
Sequence length 299
Comment pep supercontig:GCA_000226015.1:ML1122:129470:135034:1 gene:ML11228a transcript:ML11228a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWAFVFTTFCSFLLGAYGTETCSPFSKQYSGFQLRNASQHTRDCPLISVESEEICIKEF
CRIVETKKQCIGNAVQILKDGTGFLCYILQLHSCDGNGSPPCTFEKKIGSKFLFSGNSDR
NDDYEIVCPGKHRCANGICMDNVSVCNGVIECLDGSDEMECPQNVTCKTPENYLCRSDEK
CVPVTLKCDGVIDCDDGSDEMGCTEYWARKNANTTLMITAISVGVILSLLLIVLMFACGQ
KLYTNHFEQRERLRNLRLGSCKSDNGMSNKVFTRNQGRYSHPPIYRASFLSPENLPGEQ
Download sequence
Identical sequences ML11228a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]