SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML114621a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML114621a-PA
Domain Number 1 Region: 549-714,800-907
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000128
Family Rhodopsin-like 0.0089
Further Details:      
 
Domain Number 2 Region: 472-506
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 3 Region: 85-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 508-542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000982
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML114621a-PA
Sequence length 937
Comment pep supercontig:GCA_000226015.1:ML1146:159402:162215:-1 gene:ML114621a transcript:ML114621a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSTDKKIITLSEMAGWICDGEKDCAGSGRDETDCSTTFHTLPSGRKITSSMLCNGVCE
IWECEDEANCNGLTYGIYCKRDKKTTAYIHPLSLCDGWRDCANGEDEENCEEADITINTC
ETKKTRSRLLKAKVSLHNYTVCSVFDPMYFGDKNLFCKKLMLYQTNCSDEVRIGGECQID
GHMTTISKDIICNPEIEYDKHMICDDRIERTCLPISKSCTQHKHFMCDEVSDCKDNSDET
HPDCRTKTKSTCRRKIGRRGNLTLPLVWISDGVEDCINGEDELGIWPTCGAGKTYRLVAR
NETCENVFLCPGEERGYEELDLLCDGLESCGNENRICSLSRSSSKVFTDLHTSSDGFIKR
LSFCLKGLGSISKLSNNPCTTELFIFPDHQFFGVDKKSEVTLPRLVTQNCDDMFGEQYVY
TSCTNRCKNSTCPLKNLPRYEVCPNQYQDRIGTIANNEYLVFFTKTRGDNYSNKYFVCDN
KIKCIDYSQVCDLVDDCGDASDEISCTNHFRCKASRLFIPKIEKCDGNFNCPDLSDECND
LCSKEILKTPFLKVSSMIIGSMAVVANLITIARNSMALVRCKNSVALVNKTLVIIVSFGD
FLVGCYLLVVTIYDSVIFGKSYCLYQIKWVTSGICSTIGVLSTVGVQVSLFAMVGLSLVR
LNGARNSVNSMKLPGEVTEVKCFRVALVAICIVLASIAIAIIPIVNAFEDFFVNGVRFSE
KLRFFLGTSKKQDILLVIEAYYGRMKETSLCWDTIISMVRSMFSHDFGYNDHTSVVTKLD
FYGNDGVCLFKYFVNQNDPQKYYVWTILGINLICFLLISISYFLISLFTKSSAKPLAKSP
VHRLINRRNRKMNRKIAVIISTDFISWIPFSFTCVLHSMEILDATPWYSLFSMIILPINS
VINPMLYDDVVAGVVKTPFCFLRNRIFELDVFGHFGT
Download sequence
Identical sequences ML114621a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]