SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML120737b-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML120737b-PA
Domain Number 1 Region: 955-1130,1202-1308
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.38e-20
Family Rhodopsin-like 0.0036
Further Details:      
 
Domain Number 2 Region: 876-909
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 910-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML120737b-PA
Sequence length 1352
Comment pep supercontig:GCA_000226015.1:ML1207:278379:290892:-1 gene:ML120737b transcript:ML120737b-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMILSVLVVLLIGTECARLGGSGRDTDLSSNIRGRVKSSKFFGSSLGSGPGCIEPGSNEI
YPLYSVIQPAIEVFSPNTKFSDSKPRETINLDINHLNLHSFNQDTDAVVVLMNSPPEEEQ
KTDIAVQLLAPTKGRVIKDKDLFHINHSYRSGGLLEINLSDKPNYKLTGCVAAELQLPNI
TTDESAVELRVVKRYPWFALKYNGVTVVKHNFFSFKNPDCRSVWAIKANAVVVDLANIAE
LQEKSVLETGIAKQTNGIPVPEPTPTPTPVTSEERICEMVEEATYIKLRCNETDGSITFK
CPSSNDYYTYKKNGHTTSFNMSCPNDRRFYQACGHNEQNIVDIINHFDDNGLCGVFLCDL
LEDSSSDALRSDSPSVRDKICNGIADCVNTDLDEKNCDFNCKTGNSREQYLPGGKKCNGE
CDCMNCADEAECGLNTKGVFCEDRTYKEAEKICDHNDDCKGTIPMDERYCIEAECEITLY
HNGMDMNSFVYEERLKMPVSKVIRLRKEDNCDGVPRCDDSSDEQLCVTRTCQRTDLTSTK
VLTITLNDANLCTTPKSGNLYRICDDASDQTNCTDPADVALLCLNLCDDDFENNCIQITE
KCLIHKHQFCDGVYDCEGGTDEAKERCQVTGTAKCVRRYPAQRNINLPIVKLWIQDGVVD
CVDEVDEDPKRWTSCTDKRVPWATSFTEVNSTCQEFYFCAIERKQSVPFSFLCDKVNSCG
RENEVCKSSRHTKELPWTVLPKNPKTSDRNLHFCLPGLENLRLLAGNCTTELFIHPHKPF
GVTSHPKIKVPEKALDCRFLFGAPYVFASCSNLCLDGTTLCPLNKLEADSCSRLYQQKER
SFTFSMGHKNETYLSFLDTKENVSSSFDKKKAFLIPELFSCPNKRCIPFSKVCNLADDCG
DGTDEKNCTNHFKCQNGNEFVLLTNVCNGVFDCSDKSDECNENCYSNLRIIKPGHLAVCG
WTIGILAIILNVFAIIATAKQLYGEKSNIKVSNLTFIILIASGDLCVGIYLIAISIIDRR
YKADDSGLAYCTKRFDEWLSGGMCTAMGVLSTFGSQLALYAMTVLSMFRAYCVASKSLRG
LNAFRVKIALTTSACLLVLAALLTSTVPLMDAAEDFFVNGLVYQHNPLLIGDLDKEKHFD
ILQAHYGSFYQKGVLSWKTIRALVQDMFTTFNGPIIGKKIHFYGNAGVCLFKYFVRPDDP
QQAYTWFMIVQNAICFFIITASYITVHFIVARSAKRSITEKGKGKSSNKNAALNRKIAMM
ITTDFICWIPFIIICTLHYTECMDATPYYSLFSIVFMPINSVINPLLYDTTGVLELLKSC
TLRIKQKLASTSEINPESILVNSKEQTKNTSI
Download sequence
Identical sequences ML120737b-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]