SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML12232a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML12232a-PA
Domain Number 1 Region: 1544-1707,1783-1887
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000022
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number 2 Region: 1466-1499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 30-168
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000216
Family WD40-repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML12232a-PA
Sequence length 1947
Comment pep supercontig:GCA_000226015.1:ML1223:25284:38247:-1 gene:ML12232a transcript:ML12232a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTRQPILFPVLEDIEFCSCKADLVTQHDGEVYVCNPDNSHCYIFYHRDLEPNKPIQA
QELMLSQIPSFTISRIAVSPKGQKLLLWGDHGIAVVDIPRRRRANGITTCRSTLIGARFF
QGHTKIAAIDVKWHPGYTEDSHLVALTSDNILRVYSTEEPACAVSSYPLFNTDSIIPYLH
CLNVSTGPSLLSAQAGNMVSFTFGPFVEEEEAVTVFVLEENSDVFSLALPLDNRGGGELK
GPLKVLPPDNENYELDACSILCLQSNPPVLVIATLSGILQHLSLLQDPEVEEEESLYLLE
TVEIELPGLTEEGESACTQSSDEEVSAVSLLPDPTSRDRYFVRHNTGIHSVFLPAVQRLE
HFVKAEDGELNLECECVAEHMLCVQPVGAGDPTCLFGSTVVLDPMLGANLLVLISNAEFI
SLPIRSVHREEIPLLSGGEKTSHCASPMKQVHSQLFSQKLQGILARNVSNPLLRCGNSSG
MSQKALLELLMKSTQVFREEYIAKQSKARGELLHHMTLLQEQQIQHKSELTELQHTVAEL
AGEGEKLSDRSSRISKRQQLLRQRVSTVMREVQQLLPDLSTAEIAFKDEMNSMSRSLKSL
QQDAEQLHQKLKFQTKTAKNLPTLSAEQQDRVRAILKENYLCGSKLIPGAEYAAHCYCGH
QFGYFSGQLGDGATMYVGEIVNNDLERWEIQFKGAGKTPFSRTADGRKVLRSSLREFLCS
EAMFHLGVPTTRAGSCVVSTDTVVRDVLYDGHPINEKCAVILRIAPTFIRFGSFEIFKSI
DRLTGRHGPSVGKTDILKQLLRYTKTRFYPDVAGDVEEEDTVVAMYREIMERTARLAAHW
QTVSLIYQLSLISDLFINFLSFQIATKEADFFFIIEPTLRTDFACAFVRFCEIVDSQKSL
SDKKIFSQGVFDCSFSEVNDFLKETCKVTLNDSSYDVIKCPQSEVFYQALDLSTMYENRQ
VYSTSCDYDEQEYQVCGVISEISRRKYGNYFLCGYGVCERMPDSTLNSGGRYTSGENTWS
YVRCNDKLECVGGEDEMECFDGYRCYQYNVTIPFEAVCNGVYDCLYGDDEMASCNHTTGL
SCLNWNREMGWVHPFYICSKNGNSFQHSCPFDRANIKDCNIHEGGRWCRSSSESNGIRYI
KPLQMCHPYSGKSLLDYKVCDDGRDQLNCTNVVLTCPVDGHMTTVSQYGLCQGYGLCDDK
FDDDCWLAEHDCYLHRHQYCDGVDDCEHKGDETSKVCADMTAAQCVRKVSFPPQTLHSIP
KAWLCDGVVDCIDGIDEDLSHWNVCGSSRSILRCIERTEFCTEMFICPRSVKEFSSIHNL
CDYKEECPGENMICSESRGLKDLFADRVLDLRNSTNFVLSYQCLLGMQGGCITKVHNVFD
KSVYGVSNTTVTYHPSAAGVSCKFYFGKLYVYHSCNGLCTDASCPLKAVTYNSCANVPGK
VITTAKHPSGKQYLTAAYKQGSYVRNDLFMCDNGRCLTYESVCNLADDCGDHSDEKFCVN
HFKCNMSGTYSYVPLSAVCDGKADCFDLSDECNDSCGLQIIESLSLKIFAWLFGFLAVFT
NVNVLIRKILALKSTRTKTAFFNSVLVICVGFGDLLIGLYLLGISAADTVYSSSYCKLRF
EWLNSGFCTALGILSTAGSLVSILSMTCLSVYRIYSIRRLFSSRILSKRFLCFTISLLLC
LFSCVSAIVVIPILLFEDYFLNGIYYKNVNLFIGAPSLQKHIDILEKYYGRLTDSLVSWT
TIRSLVADMFTYDHGGISGSNQNFYGNSGVCVFKYFVTELDPQKMFSLSILTVNCCLCLI
MSISYVAIYVSSHSASLSARRNRSNSMEKKIALIILTDFLTWMPFIIFCYLHYFEQLDGS
SYYGFFSIIALPINSVINPLIYDDTLSNICGKYFRKLFSRSITATEDTKTNVLSDTRALS
TVHLSEVKCRFNLSNENSDSVSLDTKL
Download sequence
Identical sequences ML12232a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]