SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML12424a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML12424a-PA
Domain Number 1 Region: 637-822,880-985
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.11e-18
Family Rhodopsin-like 0.0054
Further Details:      
 
Domain Number 2 Region: 564-597
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 186-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000123
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML12424a-PA
Sequence length 1031
Comment pep supercontig:GCA_000226015.1:ML1242:17999:21092:-1 gene:ML12424a transcript:ML12424a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNKPMFSDCRLAEVGGFIKISCEGEYNYRCTHSDTYYKLYISNCETHLFSGLCLEDPG
YYQVCGHNTCQETIVLQEGPMLCGSYICSSWVNYLNYGWYVEHRGGVDALKKFSCNGVLN
CLNTVLDEAVCPANVTVCQYSGGFLDPLDVCDGKCDCYLCEDESDCSQNESPFGIVCENS
LSKRINWFPFWNTTYVPPAVICDGVDDCHNGEDEEHCEVTHRGTCHSSAKYLHGQKVTLT
SNNSCTVPNAKYTVCSNFRDQLNCSATLQSPLTCKIGGYETTVTKYAVCQDTALCDDGLE
SACFTAEGGCRVHKHRFCDGLTDCVGHGDESSSICTVLTNLSCTRRYSLNSTRAVLPIPL
DWVMDGVEDCLNGDDENSTLWEQCGSRWARRYFDPSAECTDVFICSNHSKAYIEYPLLCD
KSSSCPEESSVCKVSRNRPHIWNRVTYRSSQYEVVIGSSLPGLDSLNRLVGSVEHVAFPA
LGDPFGVSSSTVTFPNTTRHIDCKHVYGEMYVLLSCLGQCEDVPCVLKPVKHDSCQSAID
RRVLTLSNDSYLTIVRQDKGAFVSDLFPCNNGFCVHQDKVCNLMDDCGDMSDEIDCVNHF
RCKTSGELLPVTSRLDGRYDCADFSDECFDGKKIIGSVFLEVFAWGIGVFAVILNLVILF
RSLVVLKRQKCALKLLNKLMIMLISFGDLMVGTYLILISVENILTQEDYCTTLFDWLSSP
SCAFLGVLSTVGSQLSLFSMTVLSLTRVFTVGRLINYLSLNILHVSTLLTIVLIVFTCSV
AIAVLPLLAIVEDFFVNGLYYPGLPLFIGAPSKEAHMDILRSYYPKLKIDSSLTWHIVIG
LVRNMFTQDYGGVKFRKLHFFGNDGVCLFKYFVTYTDPQRAYTWCVLLINFVCFTIITIS
YILIYIKSVVSSRKITRKEEDIFSRRNRTVQRKISFIIVTDFLCWVPFISICLLHYYEVV
DASPWYSTFSIIILPINSVINPLLYDDTFTRLVQRCRDNRAVQWVSGIIFSGEGETGDQP
DQCGGVSAIKT
Download sequence
Identical sequences ML12424a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]