SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML128424a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML128424a-PA
Domain Number 1 Region: 364-539,615-721
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.02e-17
Family Rhodopsin-like 0.0034
Further Details:      
 
Domain Number 2 Region: 296-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 330-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML128424a-PA
Sequence length 771
Comment pep supercontig:GCA_000226015.1:ML1284:243788:246103:1 gene:ML128424a transcript:ML128424a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCNMRGIPTTLSVFAICLNYELCDDGYQNQCVEVEGGCLLHRNQLCDGELNCPRGTDET
ETFCSTLSTQRCIRRVKMLRDKTSQPLVFPMSWVMDGHKDCGDGIDENADYWRKCGSGQT
LRYIEKDGDCIEVFLCDMDDVNSRFVTFENLCDKIPSCGMENTVCRSARDIKRTWDHVVE
DQLNVKYLSYCLPGLKKLEQLIGSCSFTNFIAPDRNILGVQTYGIYFPVEKQECGNAFGE
FYVHLSCTGKCKHAKCPLVRVKQNSCVNILNTDKVYSLTEDYSLTIVARSRGEYVNKYFS
CNNSQCVTYDKVCNLVNDCGDDSDEKNCINHFKCAETSEYVLKTAVCDGVVDCRDFSDEC
GNSCSRESRNLLQNTFLKAFAWLSGILATLLNFTVIITSIKEINNSKSLRNRMDKSLISL
VAVGDLLIGVYLLAIAAVDAYYSKSYCKKKFVWLISTYCNILGTVSTVGSQLSLFSMAAL
GVSRLTYIKRLVPKDPNTIKSKIKLSATLAVPLIASLSISVFPLLPQFEDFFVNGLHYDG
ITLFTGMVDKETHHRVLQSYNGRYREQPISWKTVRRMVGEMFSKDYEGIAGAKVEFYGSD
SVCIFKYLVTKSDPQHVFSLAILTVNVLCFLFITACYSIIQLYVVNRSRAVVSNSSSTRR
RDLKLQTKVSIIIGTDFLCWIPFIVVCALHFFEAIDAAAWYPVFSVIILPFNSVINPLLY
SDMVFRKSNRMVGYFTSTVLTMGRNVSARMESMAQSYATGSQNTGNNTTEL
Download sequence
Identical sequences ML128424a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]