SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML135613a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML135613a-PA
Domain Number 1 Region: 300-474,539-575,606-694
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000384
Family Rhodopsin-like 0.0093
Further Details:      
 
Domain Number 2 Region: 209-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000969
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 72-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML135613a-PA
Sequence length 705
Comment pep supercontig:GCA_000226015.1:ML1356:86036:88153:-1 gene:ML135613a transcript:ML135613a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEDYVELDDKVCDFHFDIPSNLQRINQIGSFLIDADGGEVRWSCTLWSTSEICDGYSHC
LTDECGCDNSTTDVFYCSDGSGCIAWNQVCDSIQDCMDGSDECFCSGFIVAPSPLIGGRV
CMSESAYCLNSLAPSVVSHANCKKFEESQRQDNPLYMCLVEIFHEFHGIHGNARESRLLD
YCRENCSHASGNNSEWQKFCEDIILYSPYDYMFLCSNNFTQERVHLSALCDGEMDCMNHA
DEIGCPLPGRFYCDPNVTAEWVDVVKVCDGQKDCGNGADECGTCRFEAFSSSKFLIHSKI
VLAVTTLMGILIILFNLTEGYKCWFMTCATKNKAVDRLLLLQVFLYDTLMGVYMLCIVSA
ALYLEFKGDYCLLEQKWRASPYCSALGAVFSFSSHGSLLAIAFISITRFFVCHSLVGGTK
TRAVAIGSMLANILNLLHSVLPLLPVDRIQDAFRTGLYLTNVADNPFFSSNPVNVSLLSK
VYEGIVKQEKVSVLEMIRKLKNVTSKKGIFNISEIGYYGNTGLCIHNIFKDQEYQGFYET
YKILYCAVLLSLLSLVSFAYIKIVMKQRRLTKELNPTVGLTMVNPSETDTVALPGDAAKE
LSPGDGPNKKDDQMTALTIKVALMIGTQLVCWIPFILTVIYFQYLTTKSVSSMVFEMFAL
VVIPINSFLNPVFYSELYKKVKLWAWSLWRRLINFATPTSNPNEK
Download sequence
Identical sequences ML135613a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]