SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML138314a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML138314a-PA
Domain Number 1 Region: 705-832,917-1046
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000833
Family Rhodopsin-like 0.0084
Further Details:      
 
Domain Number 2 Region: 587-621
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 622-660
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000798
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML138314a-PA
Sequence length 1106
Comment pep supercontig:GCA_000226015.1:ML1383:136836:142461:-1 gene:ML138314a transcript:ML138314a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFKFTYFRNQNVFCKRKKAFSNQLHNSFLAEKGLCEIQKINGFLQSVCYSSPESGLAVY
QCPYSEERYQVLDPLSFIPDRDINGYIFNATCTNDTFAYQMCGSMTGWDTFSDEFSLCGY
LPCQYGKENFRTLAWSDICNEKRICTNLDLKDLNCSSNTREERAKQLLCNDVCDDMDCKD
ESNCNGYQYGLICQPIAYYLDYRQVCDGQSDCVGVVIDPTVEGHDELYCSLAISKGFPTC
ISGSVKGKLVPIFNFTRCNSMLYGEDNKPIPYCKNFLDQTNCTDPAKAAVKCHIQGYGIS
TVSRYIVCGKISVTGGICSDKMDLQCVRLSSNCKVHKHQQCDGVPDCDDGADERLSICRE
MTEKQCFRGYVHKKKLRIPLDWLDDGLADCIDGIDEVDEASRTRWPTCGKSETKRYVVEN
STCQDLFLCRHDLARFITIKELCDGIDTCGNENKICKISRGISSVSTAVLSVDMSKRLQY
CVKGLENIERQKIPCTSKVFNYFKEDVYGMTIEGSLIIFPQDTFDCRHIFGEAYLYLTCL
GRCNNAKCPMTRPVRYADCTDDYKNRVYTLVNKNDLTFVTDKRGVYTNNLFVCRNRKCIE
YDKVCNLIDDCGDWSDEQNCINNIKCDNNQTYISAAQMCDGKVNCEDWSDECNDVCGQQI
INGLVLKCSAFAIGLAATILNIVVTIESIYELQKFNGRVMIVINKILVMLIGVGDLLMGV
YLLSVAVVDVLYGSTFCKHRVGWLTSVKCSLLGVISTIAGQISLFSLTLLSLFRALGVKG
NINSPGSSNRTGCAAFSRFLRVFASLVVPLLSVTSLMATIPLFASFEDFFVNGMAYDSSI
KLFVEPIGKDTHFDLIQNYYGRSQRQTLKWSVIVSLVKNMFSNDYGNLHGMVHRVNFYGN
DGVCLFKYFVSHNDPQRIYSLTIQATNIVCFIVVALSYITINVTTVKTSDVLTKTDNPTA
KLVRKRNNKLQRKIAAIIATDFACWIPFVVVSGLHYFEVTDASKQYGLFSIVVLPINSVI
NPFLYSNHIASMAAKLVDTIGCNNRLSRFFRRRVVTKFRRLARRPTYNLDLAMHSINESN
VNGVPPVPEDLVHANLSVCQYQNTAL
Download sequence
Identical sequences ML138314a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]