SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML14764a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML14764a-PA
Domain Number 1 Region: 367-403
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 2 Region: 403-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000707
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML14764a-PA
Sequence length 555
Comment pep supercontig:GCA_000226015.1:ML1476:27365:29032:-1 gene:ML14764a transcript:ML14764a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMYKKLSKIIRGKSENPGQSSPDGTVRTRDYTSAEVKLNDKNTCIVPNRLYLVCTDYRD
QLNCSHALESPLICKRNKFETHISKYALCKETMLCDDRLDGNCHSPTGGCFIHKHKFCDG
VSDCSDAEDSPDEKAPDCKEMTNEFCERRFQRNNERNESLAIPLAWVMDGVADCIDDFDE
NPLNWKVCGDESTKRYIEKQNQCHDVFFCSSNKKDYTNISSLCDGRRTACMMESDICRIS
RNAPKTSDIMTRFPDTNELTIGMFLPGLKDFIQLYDNIPMSVQMHSINEPFGVSPFEVTI
PKDKKIDCRFVYGEMYVFLSCSGGCINSNCILTRPVKHNSCFNIPDHDRVFTLAKGNYLT
IARKRNHKYHSDLFPCRNNYCVPFDKVCNLVDDCGDASDEEHCNNHFQCDSKEYVPLSSV
QDGSPHCNDFSDECSENQSILTTPISVVAWLIGIPAVLLNAVALLSSIYKNFTESQRSRI
KNINTLFIILITIGDLLMGSYLLSIAVLHTTMKETYCREKFSWLVSNGCASMGVISTLAV
RITSVSIFNDVSFTL
Download sequence
Identical sequences ML14764a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]