SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML150412a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML150412a-PA
Domain Number 1 Region: 998-1120,1210-1316
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000311
Family Rhodopsin-like 0.013
Further Details:      
 
Domain Number 2 Region: 920-955
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 99-139
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000173
Family Anti-platelet protein 0.021
Further Details:      
 
Domain Number 4 Region: 957-993
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML150412a-PA
Sequence length 1385
Comment pep supercontig:GCA_000226015.1:ML1504:90709:98210:1 gene:ML150412a transcript:ML150412a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCHTLFNYRNSMVGFMLSAVYGTLLTPYLVAKWSEEEDRKCKLCEEKIGTIPLISGGYS
VALVAREGIGGGMTRSYDRFLSRLPFIANAESTPLHYSRTQFKVYDVLSLDECVAICKNE
PDCVSVTYQLSTLSCFLKNKENGAELDKINGLKSVNLLCKDCKGLNKEWTSSLETTAQLP
VEPGTVVEVTCSDTGVINTGSREVTCTPERQFAFQEEPHCSNLGKPALYSYDIESDKVIK
HTKKRGLLVMNYSKENTTHRATVCGSSEKFNFALADYFCQLLGYEICVEWGRTEDTNNDV
VKLHHTNDVWLNCGKEKDAKSWIDDGKCGTDYPLRSGEPSQCNPTGEKPCCNGNLKDCGN
TKEYCVCDKCRDYRPINNKECEISEVERFLKYRCSNQKLQDHFKCALSDTRYKPSLKTWE
ESRGVFMLTTTSDVCEKDPFVYQACGFGTLITAEQKVDALCGGNFSSVSADDENGQYKYN
EIYKPENSSGECDGICNNGNTNSDSCRDESYCGGFSYGRKCSRLGEVGYAPVHWICNDVK
GCDDNSDEEDCDELELGREYCTHYKAKYIFGEDITVPIHNFTRCAIFDISKGIFPYCIDF
FDQTDCDDTDRIGGFCEIEGKKRSISKNMVCYHFKANNQNKFCDDGSESFCEHFSFDSED
CIVHRHKMCDKSPDCRNGIDELTDDCKLMTTGFLCQRKFGKYKKRNEIPVSWLLDEKEDC
ENGEDEETSKWRECLPELNQTRYVIPRTERVGCKDVFKCNLSTYSVSVRLDIMCDGVESC
GQERQVEHEVCKFSRDFPFLKKIAPTISMNNDEVTDLCTGLVDGPRDECEQQEFLRKDKI
KAFGLTKWLNIPKSRVNCQDTFGEFYVYLSCMDRCKDATCPIGDTLLKYNSCPGQYPDRV
YTLAGEKGLTFVTKSNGKTYKNDYFQCQNKRCVEFSQVCDLTNDCGDWSDEANCVNSILC
GNNKSRISLQQRCDGLIDCYDLSDECNEHCGKQILGNLSISVICWLMGILATILNFIFII
RTAYSLKLVKTGNMLETKLLIMTIALGDLLNAVTRYIGLTKSSMKTPSHVTKRAIFKTSV
KIAIILASSAAIAFVPLVPSFENYFVEGIYYGSENNVFIGFPNKERHVNVLNAYHGDRNT
SYDLPWEEIHKNVALMFTNKHETITWQNVHYYGNDGHCLFKFFIRNDDARRSRQSFQEKT
EVVEIINFEGNGLLWCVLTVNFICFLVMSTSYIRITIQTWKSSSSSGQNSNLENVRRKEK
IEQKISLIIATDFICWIPFLVVCALHNFQFIDATNWYVYVAMVLLPVNSVLNPLLYDDTI
SGFLAPTSRKVSTRLYSFASTIYSRTSEILPQSKKREEVAPNEHKQDSPQQCCNVSTDEK
ATTNV
Download sequence
Identical sequences ML150412a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]