SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML154135a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML154135a-PA
Domain Number 1 Region: 36-95
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000675
Family UbiE/COQ5-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML154135a-PA
Sequence length 214
Comment pep supercontig:GCA_000226015.1:ML1541:407696:420224:-1 gene:ML154135a transcript:ML154135a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTIVRVYMRVTMVTIVRIYMRVTMITIVRVTTHVLMLGSCEKLPAEDCSVDVVTVVQAV
HYFDLPAFFEEVDRVLKPGGILGLVSFSIGPFCVDSPTLKQAANCITDLFIQSVLPEQAK
LLSESYKNMELPYPDRRDDQVAMVTSWSLQDYLEVCMTFSQVNNKIRALGLSVEEGYGHV
TQMLREGGMTEEDVKSVYTWSQPAVLVSARKPKV
Download sequence
Identical sequences ML154135a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]