SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML167041a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML167041a-PA
Domain Number 1 Region: 122-381
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.95e-49
Family Catalytic, N-terminal domain of histone methyltransferase Dot1l 0.000000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML167041a-PA
Sequence length 2175
Comment pep supercontig:GCA_000226015.1:ML1670:370649:400052:1 gene:ML167041a transcript:ML167041a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGQGRKHLPSSHLWVDLPLPTLGHFNNLSGLTRVTLVRVTTVRVTTVRVTTVRVTTVRV
TTVRETTVRVTTVRVTTLRVTTVHVTTVRVTTVRVTTVRVTTGKCAVDEAHELLDTIRYD
CMKELCDLYNSETKKLPCQTNSTNREPASKALLRVVLHRTYAHAVFDPEKLNSYQPFSPE
VYGETSFEMIDQLIEDVPFKKGATFLDLGSGVGQVVLQVAASNICRICYGIEQAATPCYY
ARAMETHFVRWMNFFGKPYSEFKMIEGDFLDDKYRSILQNSNTIFVNNFAFGPTLNHKLK
ERFAKFPEGVKIISSAEFRPINFRITTRNITDVGTILRVREVHPRVPGSVSWTNNDVCYF
IHTVDRSYLEEYMRLQRAKYGDKLESLMMNADRKIKERCEDYKALPALSLENDRRTHLLS
NLTEIEVPKVSSIGDLHDLLNSQLSEYLSQCSSSYGEAALQLELEQSRILKERLEEQLEH
LDRNVHAEEEQVVAALDSRLSELGLKSRDPQGIGKELLYQVNGFKILHKRLDRLSSEVSN
YQTAIKSSLLREVSTWRDNHERYSEYAAEVGLKQKLYHEVLSQLPGYDFKVLATSCQEQA
RGFKDRTKSLSKLLSNIASLEKDNFQLEKELAVKREKLAAKKKAEEMAAAAAAAEAAKLA
VLPPPKPVPKPEVTAVKPVSGQLPAPHHMPVSAPVPVSVPSKPSTPKPQLIGPPKQPHHS
QAPPPPVKIPTELTKPRPKPSVVIEQPSISDGMVRADAKENSQGMSHLDAILARNGLGHY
IGNDYNTKRPEEYLLTGHDQYRRPRDRSETKSGENTPSRPSSTTSNISHRSILQQQHKQI
NNINSLLIQQQTMAQLEQKNALGSSDLGFTSAGIRGSSDNVMLRNEQALLNEQMMHIEAP
ARAELKQTEEKVLSSGTVPAKYPGSNAGYKEKPGSMLKTTSPRLQLTTQASSTKQTVLVP
HYMLGNNTTAETMMAVKPSSASTPGSATSISTVKSTPVPKPAAGSHPSTASSQLSATISQ
LGSSSSSYFSAYGSNADPLAQKTADHSYPGPPPPSKTPAEGPKAQIPKPKHKYPFQYLNQ
VYITGYAIMIHTLKSQYPNLRPELFNDLLSRSNFNPYTYFEYLKRLDNFESTLESFYEMR
PDLGEKCKTRAQKLAEKEASQKLSEKQQQSATAAVPSLSSSMPIPPSSVASSGPLNSRPV
KESQISAPRHVSNPTIIESYISKGPPAPTISVSQPPPQGPITTELRLTKPSRDLKSPPQI
PFKSPTSSIHYPGESPNKTSPAKRPECSLQYHHLSLESFKNEPKNKVRRRNASSDVKHRN
ASESEKISPTKKEVKRTDDVTETAMMMLQLHQSMQQKHSMQKKPELVQMTDNPRAELERQ
LALSESQVISSGDKTREHPQYRHDRSKHNSGTGRPDPYSKEHVYRTNKVPESAHKTSVSR
SLPEYPGNPQVHEYGMKMNPQYREPAPPYRSRESSGQYSHGDPEEKVRDDHMGNGRNGHV
SDPKSGKMNDPSKDRHRDPFQQLRNPNYYQRDGTNTMYRESHAQRDSHNSRDGHSMREVS
HRDNPHPLSGHVSRDPNGLARENHVQGRDLHRDPHQQGGQHPNVTLRTGSSRDHPRSNNR
APPSSQHQAPVLSNHRESNYINNNSNNNNNNNNNREQSLNRPASRHGEKVSPKDKEKSTP
KMPDLNKPTSYTSMDHMKHLELQKELKGATTASAKPPLHNPRTHMITSASIPPPELKKAR
NFKDVHPRDLPSQPPEMRMAPNHIDSRASYVPHQVGNLPHPVNNRPEERKKVDEKKRVEE
KVKIADHSVKKSSDLVVKKQSDPYTHPEDVNNIDLKRKIEVKTIPSVKKSSVKENPKLAV
VTKSSDGKLRPNQDHRLRDDHGKNLHTSRIREEQVSKAREEKAREESRIREEQHKALAAS
ASLAFEFKGSPEPPARPKLSADFNARPKTQVPIDYNVPRSKPSSVDPTLASRPEDPASSP
ELVIEEEEKTEPTVKAIPDSSRHSPDSSSCVERKNANGANRMSNGGSSVLGYDLEDVSPP
STSPDHPKREITPDALMESYVNNKRRRVDPNFNHRESSNELRLNSDHQKVEEKPKEHNKI
SKFSFSNSIERPREDKSYISNNGAHLKTKEELAYSQDPVYNHVKSDNRSNFDERPIQSQD
LSSSSTDLSNIDNKS
Download sequence
Identical sequences ML167041a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]