SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML17014a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML17014a-PA
Domain Number 1 Region: 715-840,910-1041
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000128
Family Rhodopsin-like 0.0054
Further Details:      
 
Domain Number 2 Region: 590-624
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 626-663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML17014a-PA
Sequence length 1138
Comment pep supercontig:GCA_000226015.1:ML1701:63777:76807:-1 gene:ML17014a transcript:ML17014a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQRKTIAELTTCWTAATFIVKVLERRCLTFCRASNVSKQREATSLLDGVSEICPNDEF
FYQACGLTSKSYLAIDSSSSHSTLAEQYPCGYICQRTPKVETTLVTTNIHVPDILFSATG
QLNIKRCDGVNDCLNTDLDEQFCEDDQKSTDCDLTCQGSDCYDENVCNGLTYGVVCEADC
NWAEGDHCLGYEYFMSAYVCDGVENCSDGQDEKDCTIDETTSTCFNLHSQVTSRLHNFTR
CGPLTRSLGELSIGGYRLIPFCDDFMDQTNCTDSARVGMECLVNGYNTTIAKQIICPDKQ
RMEIGFHNVPTICDNGLDKACFQISPLCMVHKHLLCNNVTDCSDHGDETQEQCMVMTKTK
CLRNYRSSSRAEVPLPLAWAKDGVMDCLDGSDESEDWPTCGTERTFRAVLPSDEEGSVCD
EVFLCHDRDRKVVSFLNLCDRRESCGNELDVCSVSRMQHRTFSLALQDTQGSQNHSTKFM
LLHCLKGFPDFSYFRNDMDCSSANFYFPLRTGIFGWNKTVELSLPVKKQDCRHLYGEYYV
FLSCLGLCENVVCPITRPIKWNSCPGTLERRKIFTVDKEGQLTFLIKEKQGSDLFVCENT
KCVSYGKVCNLENDCGDFSDESMCINHFQCNESGEYLPIVQKCDGTIHCSDKSDECNEMC
GRQVVSSTSLKVVGWMVGFAAIFFNSVSLGNGILSIKASDSESAFLNKSLVILVGVGDFL
IGVYLVFISTSDTYYSNNFCNLQLDWLSSDTCVALGIISTIGSQFSLFSMTSLSLLRVSG
IMKGLFPPEERTRKSLVKSVALAGTIMLASSAISFIPLIEVFEDFFVNGLKYADSNSLFI
GCPGKAIHIEILQIYYGRLMTDSLTWSQIKVLVDNMFSSDYGGISRSQLSFYGNDPTCLF
KYFVRRDDPQKNFVLTVLSLNFTCFIVITCSYLTIVIKTNRSATKLQEMTSSKPAADSPV
KKRIARLQRVTKWIILTDFVCWVPFIVVCIVHFLDVIDATEWYPIFSLLVLPINSVINPL
LYDMSLRQSLYSIYSSFQCKIKTFCLTLFRKIDRGVSYGTSNINFAEEIGLTVRPLPTGS
TNEVTCTNETGSEFEKEQGRPEKGMVIKEQAMEKIQDKVEDKMQGNYSSEGAEAISTN
Download sequence
Identical sequences ML17014a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]