SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML190411a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML190411a-PA
Domain Number 1 Region: 594-762,835-938
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000156
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 510-544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML190411a-PA
Sequence length 1040
Comment pep supercontig:GCA_000226015.1:ML1904:69232:72354:-1 gene:ML190411a transcript:ML190411a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDIVNIQVDSSLFSQVCEHDPSFYQTCGAVTELVTGQESLVCGQYICADVSTGEVRSVT
CNSQQSPTCNNTNREEVCPDKEEGVKCDGTCDDDSCEDESRCNGLEYGKFCEKNNYHHSI
LRISSSDYLDWFYTCKLWGVHVGEGAREQFVTEYTGPTCSHTVSGEEVPIFNFTRCAALH
YSTSLVADKKVWWVNATTVPYCADLMDQTNCSDLSRVAMSCKVGGYPTNISNFIICHGRS
GVKVCDDGMEGNCKIMSPSCHVHKHKLCDKIPDCSDESDETNEYCQEMTQISCRRIVGDE
SLPIPLLWLGDGEVDCVSGGDIDEEPGWPTCGSGSTLRFVSDNTSCTDDYLCLDSQVRYV
PQKLLCDKTNTCGNENQVCRSARGIDPVQKEMLHRDGNHFVFSYCLRGFNELQFETSCAK
VETTISPVDTFGVEEVRTITMPDKLHSCDSMFGEMYLLFSCSGRCSSSPCPVTRPLSYDS
CGGQFPDRVYSIADYKHLTFVTPSGDDTYHNDYFLCRNKGCVTYDKVCDMVDNCGDWSDE
EGCTNNFYCIASNTRIAKWRKCDGKLDCRDMSDECNEECGKEIIEGLPLKISSWAIGLSA
SALNSFMIVQHVKSLRKSRSSLSLLNKLLIILIGIGDLMVGGYLFSISAIDVHFGETYCS
RQTDWLSSDYCTTLGVISTIGSQLSLFSMAGLSVTRLFGVTHAMIMSSNYGSRLNMRSCI
KVLVIVTLVIVMSVVVAIAPILSPFEDFFVNGMYYEKSNPLFVGFPDKKTHRDVIQSYYG
RIKGGHDSLSWSIFTSLVNCMFTDLYGGLKRVKVEFYGNDGVCLFKYFVQTDDPQRHFAW
GTLAVNFFCFLVISGSYLYINLVSSQSANEANNPQINSRNRRMHRKISIIIATDFACWVP
FVVISTLHSLSVMDATSWYALFSIVILPINSVVNPIIYDNSFASFVGRRISSVRNMVGRF
SAVGAEVSGQLEDQPQVPDVRTSHNVDCYSQVSDLETRNKPSCRSLGSSSKMGLEKFSEK
SETDCSLTKTQPKTIDSTEV
Download sequence
Identical sequences ML190411a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]