SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML202618a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML202618a-PA
Domain Number 1 Region: 658-837,909-1032
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.65e-17
Family Rhodopsin-like 0.0055
Further Details:      
 
Domain Number 2 Region: 591-623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 624-659
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000825
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML202618a-PA
Sequence length 1130
Comment pep supercontig:GCA_000226015.1:ML2026:151158:170177:1 gene:ML202618a transcript:ML202618a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTSWKATGASDSKECELVEVGDERKYLKEKCGNKFKCPRSDVLYSVELYTDDPLFNKWS
TNCTLKYDRLCPNDQNFYEVCGHIRSECESNFGRDLEEKFCRTYTCQYQGQVLPFLGEEI
TLGYKIISGLANKRYADCNGELTCSNTDVDEKGCPDPGASFLCMGESESYIRADQECDLT
CDCHRCNDEAECGNRTYGVMCDSTFGNHVHAMYVCNGQNNCYNGLDEQVCEEKDKVRECI
PGELHGPRFYNIFPNMIRSLFPHQICAVPRLGPYAYTCQDGLDQINCSDSSRVAMQCSMR
GFPTTLSVFAICLNYDLCDDGYQNQCVEVEGGCLLHRNQLCDEEVNCPQGTDETKTFCST
LSTQMCTRRVKMSPNKTSKQITFPMSWVMDGHQDCEDGIDENVEYWRKCGSKETLRYVEK
DENCNEVFLCDTEDEVGKFVTFENLCDKVPSCGIENIVCWNARNVKRKWDFVAQNQLNVK
YLSYCLPGMEKLEHLIGSCSFTNFIAPDRNILGVQTYKIYFPEEKQECGNAFGELYVHLS
CTDKCNHAKCPLGRVKQNSCVNILNTNKVYSLTEDYSLAIVARSRGGYVNKYFSCNNSQC
VTYDKVCNLVNDCGDDSDEKNCINHFKCAETSEYVLKTAVCDGIVDCRDFSDECGNSCSL
ASRNLLQNTFLKAFAWLSGILATLLNLTIILTSLGEIVNSQSLRNRMDKSLISLIAVGDL
LIGVYLLAIAGVDAYYSEAYCKKKFVWLTSAYCNILGTFSTVGSQLSLFSMAALGVSRLA
NIKRLVPEDPSTIKSKIKLSATVAVLVIASLAISVFPLFPQFEDFFVNGLHYDGVTLFTG
MVDKETHHRVLQSYNGRYREQPISWKTVRRMVGEMFSKDYEGIAGTKVEFYGSDSVCIFK
YLVTKSDPQHVFSLAILTVNFLCFLFITACYTIIQLYVVNQSNAVVSKVSSTRRRDLKLQ
TKVSIIIGTDFLCWIPFIVVCALHFFEAIDAAAWYPVFSVIILPFNSVINPLLYSDMVFR
KGETLRSGLCWGTSGVHQAGKIIAIPTAPGDFHMYSSTDVRLNIMNLIVSFQIFLRSKIS
DVTRSLTLKTPIKLKHLVLADSIHGQKIPLFPVALSMLTELQNQYVVDVS
Download sequence
Identical sequences ML202618a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]