SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML20834a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML20834a-PA
Domain Number 1 Region: 1375-1540,1623-1734
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.49e-19
Family Rhodopsin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 347-521,599-707
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000101
Family Rhodopsin-like 0.0077
Further Details:      
 
Domain Number 3 Region: 283-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 1302-1336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 935-957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML20834a-PA
Sequence length 1779
Comment pep supercontig:GCA_000226015.1:ML2083:24061:38723:1 gene:ML20834a transcript:ML20834a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALVSMMVQLWTVSMVITVTVLSTGAETQADCRIVEVREYLKLNCTFSNGTWAYRCTHS
DVYYQVPIELCDVQIPLTWVGDGVEDCLDGKDEDHGSWKVCGEGWSSRFQDPDSVCSDVF
LCSNITQNFEEYRNLCDRAGPCNKETEICEVSRDLPRIQSQAVLRHNSHVVIGYHLPGLV
NLEREFPLNKHSIIQFTGPDRPFGVPSQLLTIAITSTYHSLCSHVYGELYVYLSCSGYCP
GTACILKPVKFDSCHNIKENRVFTLSENNYLTIASKKKGNYVSNLFPCNNGYCVTYDKVC
NLVDDCGDGSDEVECINHFTCKTSGHMIPLSSVDDGQYDCSDLSDECFSVKSIIETPILS
VISWLIGIPATFFNVIVFLRSFAELKTFTGLFKLLNRLMILLISFGDLLVGIYLIVLSIV
NVLLKDTYCRERFKWLTSGYCAAMGVVSSTGSQISLFAMVVLSLCRVITIRRLRTSTTLR
KRHVLIAATLVSVVLLTSFTISYLPLSSSLEDFFVNGLYYDKSIKLFIGAPSKLKHISIL
EKYYSQFRGDPNLPWSTVRRLVRNMFSQTYGGVNSVKLHFYGNDGVCLFKYFVTPEDPQA
FYSLTILVLNFGCFFIITSSYFLINILSMSSSKYLKNNNQTGKVLKKRNSSLNRKLTMII
LTDFFCWVPFIVVSGLHYFMIVDASPWYATFSIIILPINSVINPLLYDSYFGTLFERVWI
RSKMLFGIATLESTLTLGGPSDFKCSPENGQTLATFVNPVASRVEACQVLGNLNTVQETE
YTAICENDPGFYQVCGHVTCPQYQYQRDGPMLCGSFMCHYYLEHTWHQNDSTGEWWQTKD
PKFVNQGGNEMTYFFQCNGNESCKNTDVDERYCEEEMFVCNNEEYVNKTNKCDGECRCYL
CQDEIGCNKDYDNFGMYCNNTFHLRIGFNVWYAPYVPPSVICDGYVDCRDGSDEVDCIGT
DTCISTENLGSKNLTLTKRNRCSVPNELYLVCQNYRDQLNCSHVLDSPLLCKVNGYMTTV
SRYALCKDTSLCDNELDKKCDAAEGGCIIHKHQFCDGHRDCPEGKDEENSICETLTNQTC
KRKFSFERPGKDLQIPLTWVGDGVEDCLDGKDEDHDSWKVCGEGWSSRFQDPDSVCSDVF
LCSNITKDFEEYKHLCDGSGSCEKEARICKISRNLPRIQSRVIVRNKDRVHLGYYLPGLE
DLEKKPALKFHSTFQFVSPDDPFGVESTELTVAMSSFSHTDCDYAYGEYYVYLTCTDSCP
GVSCVLNPVKHDSCHNLKHNRAFSLSKNNYLTVVSKIRDNYVSNLFPCNNGYCVTYDKVC
NLVDDCGDGSDEVECINHFTCETSGHMIPLSGINDGHFDCVDFSDECTGNEMIVKELHLT
VFSWIIGILAFFLNSITFFKSLSQLKGINCPSKLLNKLMILSISLGDLMVGAYLIVLAMI
NILYKDTYCQERFEWLTSGYCAAMGVVSSTGSQISLFAMVVLSLNRLLMMNRTVPRSRGT
GRMSPLQIVPIAAVVMLVISISLAVSYIPMMTIVEDFFVNGLLYDKTIKLFIGAPTKQEH
IAILEKYYSKFRGDPDLSWSTVRRLVRNMFSQSYGGVQGVRLHFYGNDGVCLFKYFVTPD
DPQAFYSLAVLLINFISFLIITSCYGIIYFKSVRPARKMTNTSARSTKAKKRESVLQRKL
ALIILTDFFCWIPFVIISGLHYMQVVDATPWYATFSILLLPINSVINPLLYNTYFTDKLV
TIRNMTVAKMGLITSVTSSNNTTIATRKNTTAGRAEQSL
Download sequence
Identical sequences ML20834a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]