SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML20835a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML20835a-PA
Domain Number 1 Region: 248-426,500-614
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.61e-19
Family Rhodopsin-like 0.0084
Further Details:      
 
Domain Number 2 Region: 183-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 218-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000864
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML20835a-PA
Sequence length 684
Comment pep supercontig:GCA_000226015.1:ML2083:44058:46112:1 gene:ML20835a transcript:ML20835a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEGWSSRFQDPDSVCSDVFLCSNITKDFEEYEHLCDRSGSCEKEARICEISRNLPKIHS
DATRHMGRVFIGHYLPGLENLIKGDFALGNHSAKPFTSPDKPFGVAPQPMTIAISPANHS
LCSHVYGELYVYLSCNGFCPETSCILRRSVKFDSCHNIKENRVFTLSDNNYLTIALRKKG
NYVSNLFPCNNGYCVTYDKICNLADDCGDGSDEVECINHFTCKTSGHMIPLSSVHNSHYD
CEDFSDECSSAKPIIKSPVLSIVSWIIGISATFLNVIVFIKSLTKINEFECPFKLVNRCM
ILLISFGDLLVGIYLIVLSIVNVLLKDTYCRERFKWLTSGYCAAMGVVSSTGSQISLFAM
VVLSLCRVITIRRFRPSTMGKKLSRLISIALTLLVLLPSFAIAYVPLLDMLEDFFVNGLY
YDKSIRLFVGAPSKQEHIAILEEYYSKFRGDPNLPWSTVRRLVRNMFSQTYGGVNSVKLH
FYGNDGVCLFKYFVTPEDPQAFYSLMILILNFICFVVITSSYILINLESISSRRALRLAK
RKTNSSLHRKLTMIILTDFFCWVPFIVVSGLHYFMIVDASHWYATFSIFILPINSVINPV
LYDSYLKTLFCTLRISSTRLLRLTSDQNTTSEITMNRNRPGMGRVKSSSTTFWRIAAENT
ATQQVQPSSLSGNKKWCDKEVSHL
Download sequence
Identical sequences ML20835a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]