SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML214326a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML214326a-PA
Domain Number 1 Region: 56-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 146-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 20-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000124
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML214326a-PA
Sequence length 188
Comment pep supercontig:GCA_000226015.1:ML2143:166858:167424:-1 gene:ML214326a transcript:ML214326a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPVLITLLVVAAVQAQDCTEGFTKCADGVQCIKEEYWCDGGDPECDDRSDEVEAVCRE
YQCTADYAKCGDGTHCTAVEYFCDGAQDCADGSDEADCKGGYVKDGKCEDADVIMCNDGL
QCVLDEFWCSGQKAHCDDKSDEADSTCLRYTCLEGYVKCKDGKQCIKESYLCDEGIPDCH
DGSDEENC
Download sequence
Identical sequences ML214326a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]