SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML21544a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML21544a-PA
Domain Number 1 Region: 636-795,881-988
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.96e-17
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 555-590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 592-625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML21544a-PA
Sequence length 1052
Comment pep supercontig:GCA_000226015.1:ML2154:51018:54493:-1 gene:ML21544a transcript:ML21544a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIVLGILFIATTLSPVTSQEPSTVAISSPTSHTITSAEETTSYSSDPLCEIKELNGFLK
NICRREGKYKCVYSDENYEDIIEFHTKEVTGFDTLCSNDPHFYQMCNKEFGRKISNGEAL
CELFMCLKGDGNVESPVMMKKMPFEQICDLDCVNTDLNKRECDEMVALPSGKLARPNEIC
NDVCDDYLCEDEGVCNGFTYGLYCERLGNISYVPPRNICKASSWCDHGEDVANCTVTDST
ETSCIKKIEGRELEVAVHNNTRCTNLNQSDFRYFVEYCVKEDVTLYQTNCTDPSRVGVTC
DIKGYKSTVSKYLICFDNTISACDDEIDSKCFETIGCKVHKHLLCDNKKDCATGADETHH
ICYSITAKTCKRRVGIGGELPIPISWINDGVWDCENGVDETGQWNTCGRGPTLRYTETND
GICENVFVCRTGIEILVLTTEKGLLKRLSYCTKGLENLQRLKKRCVLKQFKFPDDNIFGG
TNTSLALPDCKQSCDNMYGELYVYTSCTNRCINAACPLRNIPRYEVCPYQFKNRIGTIVN
NTYLMFLTESFGTIYTNRYFVCNDTLKCIDYSQVCDLVYDCIDKSDEADCTNHFKCPSSG
TLLPKTKKCDGHIDCSDLSDECNEQCSKMILDAISLKGLSWLIGITAALANMVIIVKSVR
TLKSCKTETALMNRLLIVMIAFGDFLIGCYLCTVAIYDTILLKKDYCHQQVMWITNLRCS
VVGVLSTFGSQVSLFCMTGLSIIRTYGIWNSMRIPGEVTLIKILRIAAATFILILLSAVI
AMAPIISKFEDFFVNGVKFSDGLRIFIGTSDKATVFSVIQAYHGRTKEVQLSWNTLIQMT
REMFSHDFDYEDLTKNIAKVDFYGNDGVCLFKYFVQNEDPQRLFVWSILSLNFFCFFLIS
ISYLIIGILSHRSSESMASSQNNRQITERNRRMNQRIAFIISTDFLCWVPFIVICMLHSL
ELIDATPWYGVFSMIVLPINSVFNPLLYDGTLTDVLAASLRFVSTQVKNSVIFQTVNKWL
KPVQTEEVVMLDSITTAVTDVGSSNERPDTEA
Download sequence
Identical sequences ML21544a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]