SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML218813a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML218813a-PA
Domain Number 1 Region: 686-852,937-1045
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.29e-19
Family Rhodopsin-like 0.0042
Further Details:      
 
Domain Number 2 Region: 611-646
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 647-684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML218813a-PA
Sequence length 1336
Comment pep supercontig:GCA_000226015.1:ML2188:96235:103977:-1 gene:ML218813a transcript:ML218813a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQTVIQPEECHILNVGGFLQNVCSSPDSANSTNSFAFGPKFLKCLKTDQFYNIKFKAYG
RSGRTSVDILCEDDPIFYQACASLAVFPTVPLQDKPRFLPTSGDLPCGYLCEKMGSGLDG
IISTLNLIDLAGNNKNNVDFACDGEASCLNTDLDESSCGNSTVHLPGRNSVTVRLCDYVC
DLHSCEDEWSCNGLYYGIWCDNHTLYKSPFHICGNVSSEFCADGADKVICDEGKVGGQAG
TLPMCEQTAEAVFPLYNFTRCAAIIWQYTDGIHVNFFMRSPCDDYLDQTNCTDNTRVGLH
CPVRGYMSTVSHQIVCLSRSLLTEIPSVPTICDDSLDKACIKVSVSCEVHRHRICDGLQD
CEDGSDERHKTCQDMADKTCERRYFFERIGRRSAIPMAWVHDRITDCMDGEDEEITWPKC
GFGSTRRFKNRLNSSCAEVFLCGTNRIDEFIDLSTLCDKINSCGNENRICEKSRTLVPTF
AKAFRKNPSNIGLSYCIKGVERIGFLKAEQCSEYSFMFPEKEAFGKNHSLQIHLPNLLVD
CKNFFGESYVFISCLGLCEHSPKCPLNISSNVIKFDSCPSQFGSDKVFTLDSHDKLTFLV
VNRGAGLNLLGNDIFICRNTSVCLTYDKVCDLVDDCGDGSDELSCVNHFRCKTSKEYLHV
SQKCDGVFHCLDRSDECNEACGSTILDHLWLRILTYLIGILAIILNLGVLAKNISQLYRH
KSEAALLSNSLVMVIHLGDLLGGVYLIVLASFDSYYGEAHCEHQWEWLTSFACVALGITS
TASLQISLFSMTALSFIRAAGVIKSNDDIRAPALISRKSAYKLVAIVFGVVFLSVLISCL
PIFSNLEDYFVNGIRFEDSNPLFLGSLNKKTLMAIIQEYYGRMLQINNEILSWSKIKQLV
RAMFSEDYGGIRYRTLSFYGNHPVCVFKYFVRQDDPQKSFTALLLFTNVSCFVVITASYV
VIAATSKKSIKALSPEKINVTIKKTDARLQRVIQAMIFSDFFCWIPFTCICWLHLLDAFD
ATPYYHLFSILILPINSVVNPILYESAVTRALDSVFLRIKSKCTNLHGKIKNIWQKPDLD
CTPAPTAVPHVGPSDVEDVIAVDQQSNPRYSTGTIAIELKHIGIRNKCDFDGATVLPVPL
EQNKNSNNSSVATVLEQNKNSNNSSVATVAEQNKNSNNSSGATVLEQNKNSNNSSVATVL
EQNKNSNISSVATVLEQNKNTDLTCAGYGGISWAVIVVLFVVGLLCNARLSGSWILAAIG
SLLSPALCLAVNPQPLRCTGLFGEVKDDQENFFLEGQVIITAIAAILFGIVSIRIIVVGR
NHADDSNPYQQVNALL
Download sequence
Identical sequences ML218813a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]