SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML223521a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML223521a-PA
Domain Number 1 Region: 75-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 112-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 150-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 38-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML223521a-PA
Sequence length 417
Comment pep supercontig:GCA_000226015.1:ML2235:283156:296302:1 gene:ML223521a transcript:ML223521a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQSLLLLLLVLVISLCHVTAADPQISDDVIHVDHDMCRQDQIYCDGMCKPISFRCDAF
QDCTDGSDEMDCDKCLSNQFRCADKSQCVPLPSRCDAIRDCTDGSDEVDCNSCGGNEFRC
DRDRCLSNQFKCDGKVDCRDGTDEANCDACGADQFHCATLNRCISSSLKCDGEDDCGDNS
DELPDTAGCALPKEPTQPAPTEERNESDNDEGEEEENKGTYQFTKCTDATRDCDLDQDCK
KEMTNYRLQCENQMRSDKMIPCTRECQLAYGQLLSRRPHGEAIIEQECDELGVKNVKLSC
IREAMSMSCHRELNVCFRDSVCKELHSKYVEACEETIAEHAICTNACRDSYRTFVKSPTS
RGMQANCIEVNTTIPVRCGAMSLEAAGSAAHKKSSCSQGHFALLLTVSLFFFLFNSR
Download sequence
Identical sequences ML223521a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]